BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0350 (488 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0489 + 23404757-23404812,23406170-23406296,23406418-234064... 31 0.50 10_01_0330 + 3614562-3614574,3614676-3615118,3617700-3617825,361... 27 8.1 >02_04_0489 + 23404757-23404812,23406170-23406296,23406418-23406487, 23406997-23407102,23407185-23407296,23407792-23407914, 23408017-23408176,23408300-23408376,23408474-23408526, 23408700-23408754,23409049-23409683,23410412-23410733, 23410838-23411146,23411468-23411470 Length = 735 Score = 31.1 bits (67), Expect = 0.50 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 83 NSLIIFATFFFWLSFLKCKCS 21 NS + A FFFWL F CK S Sbjct: 2 NSFLFSALFFFWLLFCSCKAS 22 >10_01_0330 + 3614562-3614574,3614676-3615118,3617700-3617825, 3618379-3618786,3618871-3619311,3619399-3619779 Length = 603 Score = 27.1 bits (57), Expect = 8.1 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +2 Query: 305 VVDGPA-IAAREDVVDTEEYREMRKTMRTLWNNFIT 409 V DG I ++V+D EEY M W NF T Sbjct: 170 VTDGKRQIVEVDNVIDEEEYNHNLHVMGNAWKNFKT 205 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,225,966 Number of Sequences: 37544 Number of extensions: 221495 Number of successful extensions: 509 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 509 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1011709100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -