BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0350 (488 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 31 0.016 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 7.4 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 22 9.8 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 22 9.8 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 22 9.8 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 31.5 bits (68), Expect = 0.016 Identities = 16/70 (22%), Positives = 37/70 (52%) Frame = +1 Query: 61 VAKIIKEFYFGDRSVNTDGVLNYVNYFSDVIFMTPALRSIKLLTEAGHDQVYLYEYSFVD 240 V++ I+ Y+ DR + D ++ ++ + +D F+ ++++L + Y Y++SF Sbjct: 378 VSQGIRNAYWQDRPLGNDIMVEWLTFHTDQQFIYAIDKTVRLHAQRSSAPTYYYQFSFDG 437 Query: 241 ENVPVCRIRM 270 + V R+ M Sbjct: 438 DLNLVKRVLM 447 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 22.6 bits (46), Expect = 7.4 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +1 Query: 109 TDGVLNYVNYFSD 147 T G LNYVN +SD Sbjct: 3127 THGELNYVNCYSD 3139 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 22.2 bits (45), Expect = 9.8 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = +2 Query: 350 TEEYREMRKTMRTLWNNFITTG 415 TE+ ++ + + W+NF TG Sbjct: 619 TEDEKDFSRKIMRYWSNFAKTG 640 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 22.2 bits (45), Expect = 9.8 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = +2 Query: 350 TEEYREMRKTMRTLWNNFITTG 415 TE+ ++ + + W+NF TG Sbjct: 619 TEDEKDFSRKIMRYWSNFAKTG 640 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 22.2 bits (45), Expect = 9.8 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = +2 Query: 350 TEEYREMRKTMRTLWNNFITTG 415 TE+ ++ + + W+NF TG Sbjct: 505 TEDEKDFSRKIMRYWSNFAKTG 526 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 486,552 Number of Sequences: 2352 Number of extensions: 8466 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43131618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -