BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0349 (346 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC016278-1|AAH16278.1| 94|Homo sapiens LOH3CR2A protein protein. 31 0.97 AF086709-1|AAD45398.1| 94|Homo sapiens NAG-7 protein protein. 31 0.97 >BC016278-1|AAH16278.1| 94|Homo sapiens LOH3CR2A protein protein. Length = 94 Score = 31.1 bits (67), Expect = 0.97 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = -1 Query: 175 LHRFYRLNNNLWHSHQPYLFRNMKLQ*ISKGKQIKYLQVCYN 50 L+ FY +NN+ H+H + ++ Q S+G + +L +C+N Sbjct: 6 LNTFYIWHNNVLHTHLVFFLPHLLNQPFSRGSFLIWLLLCWN 47 >AF086709-1|AAD45398.1| 94|Homo sapiens NAG-7 protein protein. Length = 94 Score = 31.1 bits (67), Expect = 0.97 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = -1 Query: 175 LHRFYRLNNNLWHSHQPYLFRNMKLQ*ISKGKQIKYLQVCYN 50 L+ FY +NN+ H+H + ++ Q S+G + +L +C+N Sbjct: 6 LNTFYIWHNNVLHTHLVFFLPHLLNQPFSRGSFLIWLLLCWN 47 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 39,710,167 Number of Sequences: 237096 Number of extensions: 726088 Number of successful extensions: 793 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 783 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 793 length of database: 76,859,062 effective HSP length: 80 effective length of database: 57,891,382 effective search space used: 1968306988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -