BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0346 (612 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26982| Best HMM Match : 7tm_1 (HMM E-Value=9.94922e-44) 29 2.2 SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 >SB_26982| Best HMM Match : 7tm_1 (HMM E-Value=9.94922e-44) Length = 382 Score = 29.5 bits (63), Expect = 2.2 Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = +2 Query: 347 IFNFLLDLM--SCEVLIVSLK*IKRTIPNIFSINKVIESSFSITYFTSKFYDSLDTLKSA 520 + F+L L+ S ++I++ K +KRT+ ++F +N + I + YD L TL + Sbjct: 15 LVTFVLGLVGNSLVLVIITKKRLKRTVNDMFIMNLAVTDLTLIFFIPLNIYDLLRTLPAT 74 Query: 521 L 523 + Sbjct: 75 V 75 >SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 27.9 bits (59), Expect = 6.9 Identities = 15/46 (32%), Positives = 29/46 (63%) Frame = -1 Query: 381 SQLIKSNKKLKIQIETRKVKKSYLKIN*LHQT*IIQNFSHCP*FIK 244 +++ KS +K+ I+TRK+K Y+K N L + +++ +H P +K Sbjct: 35 NRVTKSKVAVKV-IDTRKIKDDYVKRNILREALLLKR-AHHPNIVK 78 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,439,962 Number of Sequences: 59808 Number of extensions: 204337 Number of successful extensions: 370 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 355 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 370 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -