BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0343 (536 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11D3.01c |||conserved fungal protein|Schizosaccharomyces pom... 25 7.2 SPCC594.04c |||steroid oxidoreductase superfamily protein|Schizo... 25 9.5 SPAC26A3.12c |dhp1||5'-3' exoribonuclease Dhp1 |Schizosaccharomy... 25 9.5 >SPAC11D3.01c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 79 Score = 25.0 bits (52), Expect = 7.2 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -3 Query: 204 DEHWARGHNGRVSHDHGGHQGHVTNVHWARGHNGGVS 94 ++ + H G V +H + G+V + A HN VS Sbjct: 28 EKEYLEEHEGEVGEEHQKNTGNVRGGYKAAMHNPNVS 64 Score = 24.6 bits (51), Expect = 9.5 Identities = 10/57 (17%), Positives = 24/57 (42%) Frame = -3 Query: 186 GHNGRVSHDHGGHQGHVTNVHWARGHNGGVSHDHRGYTRSLGNNYRARYYDGRISND 16 GH + + + + + H G V +H+ T ++ Y+A ++ +S + Sbjct: 10 GHKAALHNPNVSEETKQREKEYLEEHEGEVGEEHQKNTGNVRGGYKAAMHNPNVSGE 66 >SPCC594.04c |||steroid oxidoreductase superfamily protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 338 Score = 24.6 bits (51), Expect = 9.5 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = -1 Query: 431 EDVIWLFFYILEMISND---NWFHSDWL 357 E +IWL FY+ I+++ NW WL Sbjct: 256 EQLIWLSFYLFGAIASESLLNWTIFAWL 283 >SPAC26A3.12c |dhp1||5'-3' exoribonuclease Dhp1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 991 Score = 24.6 bits (51), Expect = 9.5 Identities = 12/51 (23%), Positives = 20/51 (39%) Frame = -3 Query: 165 HDHGGHQGHVTNVHWARGHNGGVSHDHRGYTRSLGNNYRARYYDGRISNDH 13 + GGH+G+ NG + +H R G Y+ Y+ N + Sbjct: 940 NSRGGHEGYGGRSRGGGYSNGPPAGNHYSSNRGKGYGYQRESYNNNNRNGY 990 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,286,724 Number of Sequences: 5004 Number of extensions: 19053 Number of successful extensions: 62 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 222442660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -