BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0334 (734 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g11150.1 68417.m01807 vacuolar ATP synthase subunit E / V-ATP... 73 3e-13 At3g08560.1 68416.m00993 vacuolar ATP synthase subunit E, putati... 68 7e-12 At1g64200.1 68414.m07273 vacuolar ATP synthase subunit E, putati... 59 3e-09 At3g25640.1 68416.m03191 expressed protein contains Pfam profile... 30 1.4 At4g35680.1 68417.m05065 expressed protein contains Pfam profile... 29 2.4 At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly id... 29 2.4 At5g26680.1 68418.m03171 endonuclease, putative similar to Swiss... 28 5.6 At3g58810.2 68416.m06555 zinc transporter, putative similar to z... 28 5.6 At3g58810.1 68416.m06554 zinc transporter, putative similar to z... 28 5.6 At5g16850.1 68418.m01974 telomerase reverse transcriptase (TERT)... 28 7.4 At5g05400.1 68418.m00582 disease resistance protein (CC-NBS-LRR ... 28 7.4 At5g01840.1 68418.m00103 ovate family protein 59% similar to ova... 28 7.4 At5g58880.1 68418.m07377 hypothetical protein 27 9.8 At4g27180.1 68417.m03904 kinesin-like protein B (KATB) 27 9.8 >At4g11150.1 68417.m01807 vacuolar ATP synthase subunit E / V-ATPase E subunit / vacuolar proton pump E subunit (VATE) identical to SP|Q39258 Vacuolar ATP synthase subunit E (EC 3.6.3.14) (V-ATPase E subunit) (Vacuolar proton pump E subunit) {Arabidopsis thaliana} Length = 230 Score = 72.5 bits (170), Expect = 3e-13 Identities = 35/85 (41%), Positives = 56/85 (65%) Frame = +1 Query: 262 LNQARLKVLKVREDHVRNVLDEARKRLAEVPKDTKLYSELLVTLIVQALFQLMEPTVTIR 441 LN +R+KVL+ ++D V + D+A K L V +D Y +LL LIVQ L +L EP+V +R Sbjct: 74 LNASRIKVLQAQDDIVNAMKDQAAKDLLNVSRDEYAYKQLLKDLIVQCLLRLKEPSVLLR 133 Query: 442 VRQTDKALVESLLGKAQQDYKNRSR 516 R+ D LVE++L A+++Y +++ Sbjct: 134 CREEDLGLVEAVLDDAKEEYAGKAK 158 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +3 Query: 570 GGIELVAARGLIKISNTLESRLELIAQQLLPEIRNA 677 GG+ L + G I NTL++RL++ + LP IR + Sbjct: 188 GGVVLASRDGKIVCENTLDARLDVAFRMKLPVIRKS 223 >At3g08560.1 68416.m00993 vacuolar ATP synthase subunit E, putative / V-ATPase E subunit, putative / vacuolar proton pump E subunit, putative similar to SP|Q39258 Vacuolar ATP synthase subunit E (EC 3.6.3.14) (V-ATPase E subunit) (Vacuolar proton pump E subunit) {Arabidopsis thaliana}; contains Pfam profile PF01991: ATP synthase (E/31 kDa) subunit Length = 235 Score = 67.7 bits (158), Expect = 7e-12 Identities = 32/85 (37%), Positives = 55/85 (64%) Frame = +1 Query: 262 LNQARLKVLKVREDHVRNVLDEARKRLAEVPKDTKLYSELLVTLIVQALFQLMEPTVTIR 441 LN +R+K L+ ++D V + D A K L V D Y +LL +LI+++L +L EP+V +R Sbjct: 74 LNASRIKYLQAQDDVVTAMKDSAAKDLLRVSNDKNNYKKLLKSLIIESLLRLKEPSVLLR 133 Query: 442 VRQTDKALVESLLGKAQQDYKNRSR 516 R+ DK +VES++ A++ Y +++ Sbjct: 134 CREMDKKVVESVIEDAKRQYAEKAK 158 Score = 35.1 bits (77), Expect = 0.049 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +3 Query: 558 PDTCGGIELVAARGLIKISNTLESRLELIAQQLLPEIR 671 P GG+ L + G I NTL++RL++ +Q LP+IR Sbjct: 186 PHCSGGVVLASQDGKIVCENTLDARLDVAFRQKLPQIR 223 Score = 34.3 bits (75), Expect = 0.085 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = +2 Query: 44 LSDADVQKQIKHMMAFIEQXXXXXXXXXXXXXXXXFNIEKGRLVQQQRLKI 196 ++DADV KQI+ M+ FI Q FNIE+ +L++ + K+ Sbjct: 1 MNDADVSKQIQQMVRFIRQEAEEKANEISISAEEEFNIERLQLLESAKRKL 51 >At1g64200.1 68414.m07273 vacuolar ATP synthase subunit E, putative / V-ATPase E subunit, putative / vacuolar proton pump E subunit, putative similar to SP|Q39258 Vacuolar ATP synthase subunit E (EC 3.6.3.14) (V-ATPase E subunit) (Vacuolar proton pump E subunit) {Arabidopsis thaliana}; contains Pfam profile PF01991: ATP synthase (E/31 kDa) subunit Length = 237 Score = 59.3 bits (137), Expect = 3e-09 Identities = 34/91 (37%), Positives = 54/91 (59%), Gaps = 6/91 (6%) Frame = +1 Query: 262 LNQARLKVLKVREDHVRNVLDEARKRLAEVPKDTKL------YSELLVTLIVQALFQLME 423 LN +R+KVL+ ++D V + +EA K+L +V + Y LL LIVQ L +L E Sbjct: 74 LNASRIKVLQAQDDIVNAMKEEAAKQLLKVSQHGFFNHHHHQYKHLLKDLIVQCLLRLKE 133 Query: 424 PTVTIRVRQTDKALVESLLGKAQQDYKNRSR 516 P V +R R+ D +VES+L A ++Y +++ Sbjct: 134 PAVLLRCREEDLDIVESMLDDASEEYCKKAK 164 Score = 34.3 bits (75), Expect = 0.085 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +3 Query: 570 GGIELVAARGLIKISNTLESRLELIAQQLLPEIRNA 677 GG+ L + G I NTL++RLE+ + LPEIR + Sbjct: 194 GGVVLASRDGKIVCENTLDARLEVAFRNKLPEIRKS 229 >At3g25640.1 68416.m03191 expressed protein contains Pfam profile PF04759: Protein of unknown function, DUF617 Length = 267 Score = 30.3 bits (65), Expect = 1.4 Identities = 21/56 (37%), Positives = 29/56 (51%) Frame = +1 Query: 388 TLIVQALFQLMEPTVTIRVRQTDKALVESLLGKAQQDYKNRSRRTLC*KSTLRTFC 555 T + L QL PT ++ VR+ LV L A YK S++ L +ST RT+C Sbjct: 119 TRLPAVLIQLPTPT-SVLVREMASGLVRIALETAA--YKTDSKKKLLEESTWRTYC 171 >At4g35680.1 68417.m05065 expressed protein contains Pfam profile PF03087: Arabidopsis protein of unknown function Length = 503 Score = 29.5 bits (63), Expect = 2.4 Identities = 23/65 (35%), Positives = 32/65 (49%) Frame = -3 Query: 585 PARYHHRCRATKSSQCRLSTQRPSGSILVVLLSFSEQGLHQSLVGLTDADGDSGFHELEE 406 P+R H +++ RLS R S S + V SF + + LV LT+ G HEL E Sbjct: 24 PSRIHPLSVKLRTALSRLSIWRRSSSSISVSASFGYETVLVGLVNLTELYG--CVHELLE 81 Query: 405 SLHNK 391 S + K Sbjct: 82 SPYVK 86 >At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly identical to auxin transport protein; BIG [Arabidopsis thaliana] GI:21779966; contains Pfam profiles PF02207: Putative zinc finger in N-recognin, PF00569: Zinc finger ZZ type Length = 5098 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +3 Query: 354 KGHQTVLRAAGHTYC-AGSLPAHGTHCHHPRPSNRQGSGGVPAR 482 +GH+ V + +C G+ G+ C +P G+G PAR Sbjct: 1613 RGHRVVYSRSSRFFCDCGAGGVRGSSCQCLKPRKYNGNGSAPAR 1656 >At5g26680.1 68418.m03171 endonuclease, putative similar to Swiss-Prot:P39748 FLAP endonuclease-1 (Maturation factor 1) (MF1) [Homo sapiens] Length = 453 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -1 Query: 644 DQLQARLQSVADLDKSPGCNQLDTTTGVGRQKVLSVDFQH 525 ++LQ + DL GC+ D+ G+G Q L + QH Sbjct: 215 EELQLTMDQFIDLCILSGCDYCDSIRGIGGQTALKLIRQH 254 >At3g58810.2 68416.m06555 zinc transporter, putative similar to zinc transporter 4; ZnT4 [Mus musculus] gi|2582990|gb|AAB82593; similar to zinc transporter ZAT [Arabidopsis thaliana] gi|4206640|gb|AAD11757; member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, PMID:11500563 Length = 393 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -2 Query: 358 PLALQPGACELHQVHYVRDLHALSVPSDELGSAC 257 P L+ G CE+ +V V +LH ++ +L AC Sbjct: 323 PTMLEKGVCEIEEVVAVHELHIWAITVGKLLLAC 356 >At3g58810.1 68416.m06554 zinc transporter, putative similar to zinc transporter 4; ZnT4 [Mus musculus] gi|2582990|gb|AAB82593; similar to zinc transporter ZAT [Arabidopsis thaliana] gi|4206640|gb|AAD11757; member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, PMID:11500563 Length = 432 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -2 Query: 358 PLALQPGACELHQVHYVRDLHALSVPSDELGSAC 257 P L+ G CE+ +V V +LH ++ +L AC Sbjct: 362 PTMLEKGVCEIEEVVAVHELHIWAITVGKLLLAC 395 >At5g16850.1 68418.m01974 telomerase reverse transcriptase (TERT) identical to telomerase reverse transcriptase [Arabidopsis thaliana] GI:5880683 Length = 1123 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/64 (23%), Positives = 35/64 (54%), Gaps = 2/64 (3%) Frame = -2 Query: 697 VRVASEEALRISGSSCWAISSKRDSRVLLILISPLAATS--SIPPQVSGDKKFSVSTFNT 524 +++ EE + + + + K++SR ++LI +A S S+ Q+S + +++ N+ Sbjct: 1056 LKLYKEEVIWLGLDAYIQVLKKKNSRYRMLLIYLKSALSKHSLSQQLSSELRYATDRSNS 1115 Query: 523 TSFW 512 +S W Sbjct: 1116 SSLW 1119 >At5g05400.1 68418.m00582 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 874 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +1 Query: 277 LKVLKVREDHVRNVLDEARKRLAEV 351 LK +KV+ED N+LDE ++ L+EV Sbjct: 54 LKRIKVQEDRGLNLLDEVQQWLSEV 78 >At5g01840.1 68418.m00103 ovate family protein 59% similar to ovate protein (GI:23429649) [Lycopersicon esculentum]; contains TIGRFAM TIGR01568 : uncharacterized plant-specific domain TIGR01568 Length = 270 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 455 TRLWWSPCSEKLNKTTRIDP 514 T W SPCS KL+KT P Sbjct: 127 TGSWHSPCSSKLSKTATFTP 146 >At5g58880.1 68418.m07377 hypothetical protein Length = 1088 Score = 27.5 bits (58), Expect = 9.8 Identities = 24/99 (24%), Positives = 46/99 (46%), Gaps = 9/99 (9%) Frame = +1 Query: 259 MLNQARLKVLKVREDHVRNVLD----EARKRLAEVPKDTKLYSELLVTLIVQ-----ALF 411 ++ A K + V E+ NVL+ A +L ++ S ++ L VQ L Sbjct: 794 LVKSADEKAMLVEEEKTHNVLEASSSNAHTQLVDLDYGNAENSSDVILLQVQDSHKSPLD 853 Query: 412 QLMEPTVTIRVRQTDKALVESLLGKAQQDYKNRSRRTLC 528 + ++ ++ V +T+ L++ G++ Q+YKNR C Sbjct: 854 ESVDQEISKEVEKTE--LLKDFCGESTQEYKNRGNVEAC 890 >At4g27180.1 68417.m03904 kinesin-like protein B (KATB) Length = 745 Score = 27.5 bits (58), Expect = 9.8 Identities = 27/90 (30%), Positives = 40/90 (44%), Gaps = 1/90 (1%) Frame = +1 Query: 253 LNMLNQARLKV-LKVREDHVRNVLDEARKRLAEVPKDTKLYSELLVTLIVQALFQLMEPT 429 +N + A L+V LKV+E+ + V+DE RK A V +L E L E Sbjct: 96 MNEKHCADLEVNLKVKEEELNMVIDELRKNFASV--QVQLAKEQTEKLAANESLG-KERE 152 Query: 430 VTIRVRQTDKALVESLLGKAQQDYKNRSRR 519 I V A+ E L K Q + + ++R Sbjct: 153 ARIAVESLQAAITEE-LAKTQGELQTANQR 181 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,115,904 Number of Sequences: 28952 Number of extensions: 276441 Number of successful extensions: 816 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 800 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 816 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1614253080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -