BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0328 (684 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43527| Best HMM Match : Trypsin (HMM E-Value=0) 30 2.0 SB_37182| Best HMM Match : DUF225 (HMM E-Value=1) 29 2.7 SB_26948| Best HMM Match : LIM (HMM E-Value=2.3e-39) 28 6.1 SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_56319| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_48258| Best HMM Match : Kelch_1 (HMM E-Value=0) 28 8.1 SB_43991| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_30797| Best HMM Match : Notch (HMM E-Value=2.4e-07) 28 8.1 SB_5845| Best HMM Match : Ribosomal_S27 (HMM E-Value=8.3) 28 8.1 >SB_43527| Best HMM Match : Trypsin (HMM E-Value=0) Length = 366 Score = 29.9 bits (64), Expect = 2.0 Identities = 8/24 (33%), Positives = 17/24 (70%) Frame = +2 Query: 311 HPEFSEENYDKDVSIVRVTHAIHF 382 HP +S ++YD D++++R+ + F Sbjct: 199 HPHYSPDSYDSDIALIRLAQPVTF 222 >SB_37182| Best HMM Match : DUF225 (HMM E-Value=1) Length = 1282 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 3/62 (4%) Frame = +1 Query: 178 PTTTTFQLLPVSMENSTILHTVALSLIFPSQ*AR*N---ILCSLCC*PSRIL*GELRQGC 348 P+ ++P++ + H V +S+ FPS+ A + I CS C P R+L C Sbjct: 747 PSRAHVDVIPIACSCRCVPHHVLMSMCFPSR-AHVDVFPITCSCRCVPHRVLMSMCSPSC 805 Query: 349 EH 354 H Sbjct: 806 AH 807 >SB_26948| Best HMM Match : LIM (HMM E-Value=2.3e-39) Length = 351 Score = 28.3 bits (60), Expect = 6.1 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -3 Query: 646 HPSQYCRSRGHQPGPNRRRICYQSRRDHDPCTV 548 +PS+ C + P +++ YQS+ HD C + Sbjct: 171 NPSKVCAACNGDFAPGEKKVGYQSKTFHDKCFI 203 >SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1465 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +1 Query: 523 VTNKENCREQYKGHDRVVTDNKFCAGLVRAGGRDYDNTDLG 645 V N C++ Y+ VT N CAG + RD N D G Sbjct: 1321 VVNHNACKKAYENETWPVTSNMLCAG-YKNKSRDSCNRDSG 1360 >SB_56319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 3/26 (11%) Frame = +2 Query: 215 WRILRS---CIPSHYR*SSRRSEPGE 283 WRILR+ C HYR + R EPGE Sbjct: 99 WRILRTKTTCPVRHYRFNRRVQEPGE 124 >SB_48258| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 473 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +3 Query: 105 SLVQIEVFLPILNQWFQQCAGIVLTNYHYLSTATCFHGEFY 227 +LV +E + P N+W ++ +LT Y STA G+ Y Sbjct: 111 NLVSMERYDPSTNEWEEEAVAPMLTARKYFSTAV-LDGKLY 150 >SB_43991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 27.9 bits (59), Expect = 8.1 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 1/71 (1%) Frame = -3 Query: 508 VEVAVRYTAALNGSSPSEQI-NKNTLGYYDTLLDNSTLLDVWAEVDGMCYSYDAHILVVI 332 +++ V Y AA+ S Q N+N L Y + D + A + M SY+ + + Sbjct: 303 MKIKVNYVAAVQDESTYSQFYNENNLKYEEEFTDVLENIKTRARIVIMVTSYNMAVEGMH 362 Query: 331 LLREFGMVNSK 299 L + G++N + Sbjct: 363 LAKNRGLINGE 373 >SB_30797| Best HMM Match : Notch (HMM E-Value=2.4e-07) Length = 778 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/60 (21%), Positives = 25/60 (41%) Frame = -1 Query: 615 TSPDQTGAEFVISHDAIMTLVLFPAVFFVGHNEFELWRLPSDTLPP*TVVPHPSRSTKIP 436 +S +QT + + L ++P + W++P+ TLP T + K+P Sbjct: 213 SSDNQTTLVPTVVKPEFLPLTVYPVIINDNDRAINYWQIPNSTLPRPTWIALSQEEYKVP 272 >SB_5845| Best HMM Match : Ribosomal_S27 (HMM E-Value=8.3) Length = 265 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 3/26 (11%) Frame = +2 Query: 215 WRILRS---CIPSHYR*SSRRSEPGE 283 WRILR+ C HYR + R EPGE Sbjct: 63 WRILRTKTKCPVRHYRFNRRVQEPGE 88 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,543,853 Number of Sequences: 59808 Number of extensions: 552418 Number of successful extensions: 1408 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1256 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1406 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -