BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0327 (596 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0033 + 12530311-12531264 28 4.9 11_06_0768 + 27129007-27129038,27129140-27129220,27129723-271300... 27 8.6 >12_02_0033 + 12530311-12531264 Length = 317 Score = 28.3 bits (60), Expect = 4.9 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 315 TYFHCFTFNVFHQFITL 265 TYFH NVFH+F +L Sbjct: 301 TYFHLIPLNVFHKFFSL 317 >11_06_0768 + 27129007-27129038,27129140-27129220,27129723-27130089, 27130165-27130255,27130515-27130595,27130764-27131830, 27132060-27132071,27132465-27133209,27133210-27135244, 27135712-27135787,27135925-27136029,27137080-27137166 Length = 1592 Score = 27.5 bits (58), Expect = 8.6 Identities = 18/86 (20%), Positives = 46/86 (53%), Gaps = 7/86 (8%) Frame = +1 Query: 190 KWLAEPIE-IYNVNDATHPET*VLSI*CNELMKNIECKTVKIRLVFISQISTKFD----- 351 +W+ +P + +YN++++ ++ + CNEL++N++ + + KF+ Sbjct: 1111 EWMQDPYQGVYNMDNSRGFDSAFVDSSCNELIQNVDGDSEMDLYSEQFKEQVKFEDGHLL 1170 Query: 352 IYNTKKYRFQM-LPCSFDDHNVADME 426 I+N +++ +Q+ P H+ ++ME Sbjct: 1171 IWNPREWEYQLPSPPPHGQHSGSEME 1196 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,391,569 Number of Sequences: 37544 Number of extensions: 296739 Number of successful extensions: 572 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 572 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -