BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0325 (757 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 25 0.77 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 25 0.77 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 25 0.77 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 25 0.77 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 23 4.1 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 23 4.1 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 5.4 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 25.0 bits (52), Expect = 0.77 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +2 Query: 608 FRNSTDNYKIENHLYKMTR*TSKLFYFSE*FCSHQHQTV 724 +RN T NY + HL + +F F + CS +++ Sbjct: 169 YRNGTVNYLMRRHLILSCQGRLNIFPFDDPLCSFAIESI 207 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 25.0 bits (52), Expect = 0.77 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +2 Query: 608 FRNSTDNYKIENHLYKMTR*TSKLFYFSE*FCSHQHQTV 724 +RN T NY + HL + +F F + CS +++ Sbjct: 169 YRNGTVNYLMRRHLILSCQGRLNIFPFDDPLCSFAIESI 207 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 25.0 bits (52), Expect = 0.77 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +2 Query: 608 FRNSTDNYKIENHLYKMTR*TSKLFYFSE*FCSHQHQTV 724 +RN T NY + HL + +F F + CS +++ Sbjct: 220 YRNGTVNYLMRRHLILSCQGRLNIFPFDDPLCSFAIESI 258 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 25.0 bits (52), Expect = 0.77 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +2 Query: 608 FRNSTDNYKIENHLYKMTR*TSKLFYFSE*FCSHQHQTV 724 +RN T NY + HL + +F F + CS +++ Sbjct: 169 YRNGTVNYLMRRHLILSCQGRLNIFPFDDPLCSFAIESI 207 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 22.6 bits (46), Expect = 4.1 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = -3 Query: 587 KTDYLCGEIFTKNSFFN-----PKIQHAVYKDNILLKHRLINVSTFLF 459 KT L E KNSFFN ++ + Y L R++N + F F Sbjct: 445 KTVNLAAEKKDKNSFFNMFKKFASLKKSPYFKEANLNTRMLNDNVFAF 492 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 22.6 bits (46), Expect = 4.1 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = -3 Query: 587 KTDYLCGEIFTKNSFFN-----PKIQHAVYKDNILLKHRLINVSTFLF 459 KT L E KNSFFN ++ + Y L R++N + F F Sbjct: 445 KTVNLAAEKKDKNSFFNMFKKFASLKKSPYFKEANLNTRMLNDNVFAF 492 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.2 bits (45), Expect = 5.4 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 392 YYYYCVFNHFFYLNSNNI 445 +Y CV F YL+S NI Sbjct: 470 FYTACVVEAFDYLHSRNI 487 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,410 Number of Sequences: 438 Number of extensions: 3755 Number of successful extensions: 24 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -