BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0320 (721 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 24 1.1 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 22 5.8 AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-mon... 21 7.6 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 21 7.6 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 21 7.6 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 644 IDTKNCSTKQYIDNRKTIKATLSN 573 I K+CSTK+Y+ T+ +SN Sbjct: 780 ITQKSCSTKRYVTPVNTLVRGISN 803 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 21.8 bits (44), Expect = 5.8 Identities = 19/65 (29%), Positives = 27/65 (41%) Frame = -3 Query: 653 DTNIDTKNCSTKQYIDNRKTIKATLSNILKRAALTHNSSSIFICS*FKTMNIS*VTY*FV 474 DT + N ST +K +L ILK + ++ IF S F N++ VT Sbjct: 354 DTVLFILNISTIIITARKKQQWNSLIKILKTVSNRNDKGDIFWFSPFLVANLAFVTIVTY 413 Query: 473 ILFNW 459 F W Sbjct: 414 ETFVW 418 >AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 212 Score = 21.4 bits (43), Expect = 7.6 Identities = 12/46 (26%), Positives = 21/46 (45%) Frame = -3 Query: 665 WLWLDTNIDTKNCSTKQYIDNRKTIKATLSNILKRAALTHNSSSIF 528 W+ L ++ N KQ ++NRK + L L +S++F Sbjct: 160 WIPLCNSVTFSNFGYKQCVENRKWQNKVIQKFLWTGGLV--TSALF 203 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.4 bits (43), Expect = 7.6 Identities = 12/46 (26%), Positives = 21/46 (45%) Frame = -3 Query: 665 WLWLDTNIDTKNCSTKQYIDNRKTIKATLSNILKRAALTHNSSSIF 528 W+ L ++ N KQ ++NRK + L L +S++F Sbjct: 393 WIPLCNSVTFSNFGYKQCVENRKWQNKVIQKFLWTGGLV--TSALF 436 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.4 bits (43), Expect = 7.6 Identities = 12/46 (26%), Positives = 21/46 (45%) Frame = -3 Query: 665 WLWLDTNIDTKNCSTKQYIDNRKTIKATLSNILKRAALTHNSSSIF 528 W+ L ++ N KQ ++NRK + L L +S++F Sbjct: 393 WIPLCNSVTFSNFGYKQCVENRKWQNKVIQKFLWTGGLV--TSALF 436 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,204 Number of Sequences: 336 Number of extensions: 3176 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19155320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -