BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0320 (721 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0338 + 22479804-22480651,22480764-22482954 28 8.6 06_03_0805 + 24775346-24775543,24775643-24775858,24775930-247759... 28 8.6 01_06_1406 - 37073548-37073822,37073892-37074111,37074200-370742... 28 8.6 >11_06_0338 + 22479804-22480651,22480764-22482954 Length = 1012 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -3 Query: 641 DTKNCSTKQYIDNRKTIKATLSNILKRAALTHNSSSIFI 525 + K C +YI N +K T+ + K A HNS +FI Sbjct: 916 EAKICYNARYI-NSPNVKRTVEVVSKEVAKHHNSIDLFI 953 >06_03_0805 + 24775346-24775543,24775643-24775858,24775930-24775970, 24776510-24776551,24777019-24777055,24779796-24780092 Length = 276 Score = 27.9 bits (59), Expect = 8.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 472 YCSTGCYLFCIHLDVC 425 +CS GC L +HLD+C Sbjct: 132 FCSLGCKLATLHLDLC 147 >01_06_1406 - 37073548-37073822,37073892-37074111,37074200-37074246, 37074404-37074576,37075161-37075238,37075751-37075813, 37075889-37075961,37076150-37076189,37076302-37076368, 37076719-37078472,37079128-37079230,37080041-37080078, 37080221-37080347,37081944-37082152 Length = 1088 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 133 CPANANVETNKQNDSNERNTIVLLFNIQ 50 CP V+ K++ SNER+++VL Q Sbjct: 592 CPGKGRVQDKKKSVSNERSSVVLSVEAQ 619 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,540,723 Number of Sequences: 37544 Number of extensions: 287845 Number of successful extensions: 684 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 669 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 684 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1874582652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -