BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0316 (441 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 6.4 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 23 6.4 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 22.6 bits (46), Expect = 6.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 293 WQYPFQLEILGNYCGYLRFCAALIS 219 W+ Q L C Y+ FC+AL+S Sbjct: 113 WREVQQPPRLSRLCIYVVFCSALLS 137 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 22.6 bits (46), Expect = 6.4 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 5 RTTTGNKRCSIR*SYSHRRIWCQQKRLGHCY 97 R+ T RC +R + H+R W + CY Sbjct: 448 RSLTEMGRCMLRDAGMHKRFWAEAVNTA-CY 477 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 490,552 Number of Sequences: 2352 Number of extensions: 10249 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36993357 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -