BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0314 (502 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53150-1|AAA96123.2| 302|Caenorhabditis elegans Serpentine rece... 28 4.4 Z81546-6|CAB04457.1| 425|Caenorhabditis elegans Hypothetical pr... 27 5.8 >U53150-1|AAA96123.2| 302|Caenorhabditis elegans Serpentine receptor, class sx protein32 protein. Length = 302 Score = 27.9 bits (59), Expect = 4.4 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +2 Query: 17 NSLQIVYYLKNTNIHYEIVHYLVTSGCV 100 NS+ I+ ++K N H HY++T C+ Sbjct: 27 NSIMIILFIKEKNFH-SPCHYMITFSCL 53 >Z81546-6|CAB04457.1| 425|Caenorhabditis elegans Hypothetical protein F53A2.9 protein. Length = 425 Score = 27.5 bits (58), Expect = 5.8 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = -1 Query: 421 ENLKVT*TFV*YNSGDYRQFWLRNI*IYSIRLKL 320 E L+++ TFV + Y ++WLRN I ++R+K+ Sbjct: 137 EKLRLSATFV-ERTSRYIEYWLRNFQIDTLRIKV 169 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,330,033 Number of Sequences: 27780 Number of extensions: 235974 Number of successful extensions: 517 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 517 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 956602620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -