BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0314 (502 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80680.1 68414.m09467 nucleoporin family protein contains Pfa... 27 7.1 >At1g80680.1 68414.m09467 nucleoporin family protein contains Pfam profile: PF04096 nucleoporin autopeptidase Length = 1046 Score = 27.1 bits (57), Expect = 7.1 Identities = 13/46 (28%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 319 IISDVLNIFKCSLTKIVYNHR-----YCIKQMFKLPLNSHKNINKI 441 ++S V+N K ++ K+V++ + I F+ PL+ HK +N + Sbjct: 399 VLSSVINKEKIAIDKVVWDRKGKVQKELIDSAFEAPLSLHKELNHV 444 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,038,205 Number of Sequences: 28952 Number of extensions: 194248 Number of successful extensions: 318 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 315 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 318 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 888318720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -