BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0312 (749 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0151 - 5035572-5035954,5036309-5036324,5036420-5037040 29 3.0 01_01_0847 - 6611378-6611554,6612181-6612366,6612547-6612658,661... 29 5.2 >09_02_0151 - 5035572-5035954,5036309-5036324,5036420-5037040 Length = 339 Score = 29.5 bits (63), Expect = 3.0 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 3/68 (4%) Frame = -3 Query: 375 CCLFAWYSLCILYFILLINKWMLMIA*FK*KPPLPSYNFIYLKI*E-TFQS*SLKLY--L 205 CC+ W C L+ I+ A F KP PSY+ + + + F S L LY L Sbjct: 21 CCVLCW-CCCFLFLIVAALAGAAAYALFLYKPKAPSYSVSNMSVSQFDFNSNDLTLYTKL 79 Query: 204 VSQFTSQN 181 V+ ++N Sbjct: 80 VATVRAEN 87 >01_01_0847 - 6611378-6611554,6612181-6612366,6612547-6612658, 6612748-6612784,6612866-6612905 Length = 183 Score = 28.7 bits (61), Expect = 5.2 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -3 Query: 375 CCLFAWYSLCILYFILLINKWML 307 C L+ WY L + Y ++L K++L Sbjct: 53 CLLYTWYGLPVAYLMILFQKFVL 75 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,951,441 Number of Sequences: 37544 Number of extensions: 341854 Number of successful extensions: 570 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 570 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -