BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0306 (451 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 97 6e-23 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 94 5e-22 EF013227-1|ABK54581.1| 119|Apis mellifera elongation factor 1-a... 27 0.071 X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 22 3.6 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 22 3.6 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 22 3.6 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 6.2 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 97.5 bits (232), Expect = 6e-23 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = +3 Query: 3 SIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVNF 155 SIKSGDAAIV LVPSKP+C E+FQEFPPLGRFAVRDMRQTVAVGVIKAV F Sbjct: 393 SIKSGDAAIVMLVPSKPMCAEAFQEFPPLGRFAVRDMRQTVAVGVIKAVTF 443 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 94.3 bits (224), Expect = 5e-22 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = +3 Query: 3 SIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVNF 155 SIKSGDAAIV L P+KP+CVE+FQEFPPLGRFAVRDMRQTVAVGVIK+V F Sbjct: 393 SIKSGDAAIVMLQPTKPMCVEAFQEFPPLGRFAVRDMRQTVAVGVIKSVTF 443 >EF013227-1|ABK54581.1| 119|Apis mellifera elongation factor 1-alpha protein. Length = 119 Score = 27.5 bits (58), Expect = 0.071 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +3 Query: 3 SIKSGDAAIVNLVPSK 50 SIKSGDAAIV L P+K Sbjct: 104 SIKSGDAAIVMLQPTK 119 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 21.8 bits (44), Expect = 3.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 250 CMKNCAVNSSSYFLPLVAFS 191 C+KN A SSYF+ + F+ Sbjct: 98 CLKNSADTISSYFVGKMYFN 117 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.8 bits (44), Expect = 3.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 250 CMKNCAVNSSSYFLPLVAFS 191 C+KN A SSYF+ + F+ Sbjct: 103 CLKNSADTISSYFVGKMYFN 122 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.8 bits (44), Expect = 3.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 250 CMKNCAVNSSSYFLPLVAFS 191 C+KN A SSYF+ + F+ Sbjct: 103 CLKNSADTISSYFVGKMYFN 122 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.0 bits (42), Expect = 6.2 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +1 Query: 16 EMQPLSTWYLPSL 54 + P+ WY+PSL Sbjct: 589 DKNPVQLWYVPSL 601 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,394 Number of Sequences: 438 Number of extensions: 2193 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -