BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0305 (581 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43840| Best HMM Match : NDK (HMM E-Value=0) 124 5e-29 SB_45281| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_10572| Best HMM Match : Glyco_hydro_12 (HMM E-Value=3) 29 2.8 SB_57396| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_13421| Best HMM Match : Harpin (HMM E-Value=0.62) 28 4.8 >SB_43840| Best HMM Match : NDK (HMM E-Value=0) Length = 786 Score = 124 bits (299), Expect = 5e-29 Identities = 55/80 (68%), Positives = 62/80 (77%) Frame = +1 Query: 256 VVPMVWEGLNVVKTGRQMLGATNPADSQPGTIRGDLCIQVGRNIIHGSDSVESAKKEIGL 435 V MVWEGL VVKT R MLG T+PA S PGTIRGD I +GRNIIHGSD+VE+AK+EI L Sbjct: 707 VCAMVWEGLGVVKTARVMLGETDPAKSLPGTIRGDFSIHIGRNIIHGSDAVETAKEEIAL 766 Query: 436 WFTDKEVVGWTPANENWVYE 495 WF D E+V WTP N W+YE Sbjct: 767 WFKDDELVDWTPCNNPWMYE 786 Score = 110 bits (265), Expect = 7e-25 Identities = 52/67 (77%), Positives = 59/67 (88%) Frame = +2 Query: 53 ERTFIMVKPDGVQRGLVGTIIERFEKKGFKLVGLKFVWPSEELLQQHYSDLASRPFFPGL 232 ERTFIMVKPDGVQRGLVG II+RFE+KGFKLV LK V SEE L++HY+DLA PF+PGL Sbjct: 127 ERTFIMVKPDGVQRGLVGEIIKRFEQKGFKLVALKMVQESEEHLKKHYADLAHLPFYPGL 186 Query: 233 VKYMSSG 253 VK+MSSG Sbjct: 187 VKFMSSG 193 Score = 91.1 bits (216), Expect = 6e-19 Identities = 41/65 (63%), Positives = 49/65 (75%) Frame = +2 Query: 53 ERTFIMVKPDGVQRGLVGTIIERFEKKGFKLVGLKFVWPSEELLQQHYSDLASRPFFPGL 232 ERTF+M+KPD V RGL+G II RFEKKGFKLV +KFV SE+ ++HY LA F+ GL Sbjct: 639 ERTFLMIKPDAVSRGLIGEIISRFEKKGFKLVAMKFVKKSEDHFRKHYESLAKLKFYDGL 698 Query: 233 VKYMS 247 KYMS Sbjct: 699 CKYMS 703 Score = 34.3 bits (75), Expect = 0.074 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = +1 Query: 328 ADSQPGTIRGDLCIQVG 378 ADS+PGTIRGD C+ +G Sbjct: 199 ADSKPGTIRGDFCVHIG 215 >SB_45281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1256 Score = 42.3 bits (95), Expect = 3e-04 Identities = 25/67 (37%), Positives = 37/67 (55%) Frame = +2 Query: 53 ERTFIMVKPDGVQRGLVGTIIERFEKKGFKLVGLKFVWPSEELLQQHYSDLASRPFFPGL 232 + T ++KP+ V+ I +R ++ GFK+ K V S+EL Q Y + + FF GL Sbjct: 673 QSTVAVIKPE-VEPDQRELIKQRIKEAGFKIQLQKEVTLSKELASQFYHEHEGKDFFEGL 731 Query: 233 VKYMSSG 253 YMSSG Sbjct: 732 TDYMSSG 738 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/69 (30%), Positives = 39/69 (56%) Frame = +2 Query: 47 QRERTFIMVKPDGVQRGLVGTIIERFEKKGFKLVGLKFVWPSEELLQQHYSDLASRPFFP 226 Q +RT +++PD + R +I+ + ++ GF++ K + + E ++ YS+ + FF Sbjct: 536 QLQRTLALIRPDAL-RSRRESIMSKIQEAGFEIAMSKEMHLTREQAEEFYSEHKDQEFFD 594 Query: 227 GLVKYMSSG 253 LV MSSG Sbjct: 595 TLVTNMSSG 603 Score = 31.9 bits (69), Expect = 0.39 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 3/68 (4%) Frame = +1 Query: 265 MVWEGLNVVKTGRQMLGATNPADSQ---PGTIRGDLCIQVGRNIIHGSDSVESAKKEIGL 435 MV + V R ++G +P ++ P +IR L V +N++HG E A K I Sbjct: 743 MVLSKEDAVSGWRSLMGPVDPEQAKEMAPESIRAALGKDVMKNVVHGPSDPEKAGKVIKE 802 Query: 436 WFTDKEVV 459 +F + +++ Sbjct: 803 FFPEAKIL 810 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = +1 Query: 283 NVVKTGRQMLG---ATNPADSQPGTIRGDLCIQVGR-NIIHGSDSVESAKKEIGLWFTDK 450 + ++ R MLG D P ++R ++ N +HGSD+ E+A+KEI +F + Sbjct: 614 DAIEGWRGMLGPKEVEKAKDEAPESLRAQFQVEDSPINPLHGSDTAENAEKEIQKFFPMQ 673 Query: 451 EVV 459 V Sbjct: 674 STV 676 Score = 28.7 bits (61), Expect = 3.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 382 NIIHGSDSVESAKKEIGLWFTD 447 N +HG DS ESA +E+ +F D Sbjct: 501 NAVHGCDSNESAARELAFFFPD 522 >SB_10572| Best HMM Match : Glyco_hydro_12 (HMM E-Value=3) Length = 294 Score = 29.1 bits (62), Expect = 2.8 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +2 Query: 209 SRPFFPGLVKYMSSGLWSLWYGRAL 283 + P PG+ K++ SG W +W G + Sbjct: 200 NNPILPGVPKFLISGGWPMWCGNEI 224 >SB_57396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 757 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 455 LWAGHLQMKTGFMSKFILSVYFVLFS*FMLNIL 553 LW GHL++ G +LS + +L F+LN+L Sbjct: 296 LWRGHLKVIQGKFGSGVLSYFVLLRWLFLLNVL 328 >SB_13421| Best HMM Match : Harpin (HMM E-Value=0.62) Length = 375 Score = 28.3 bits (60), Expect = 4.8 Identities = 19/50 (38%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Frame = -3 Query: 339 LRVSWVSCAKHLTASL--HNIKALPYHRDHSPELMYFTRPGKKGRDAKSL 196 LRVSW S H ASL H +L H SP+ P G+ SL Sbjct: 226 LRVSWASLKSHGAASLKSHEAASLKSHVAASPKSHGAASPSLMGQHFSSL 275 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,246,408 Number of Sequences: 59808 Number of extensions: 377216 Number of successful extensions: 1061 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 983 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1061 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1397989795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -