Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= mg--0304
         (689 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_04_0021 - 15151645-15151809,15152184-15152343,15152548-151530...    28   6.1  

>01_04_0021 -
           15151645-15151809,15152184-15152343,15152548-15153025,
           15153243-15153291,15153585-15153734
          Length = 333

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 6/44 (13%)
 Frame = +1

Query: 457 ILSPAC---LRSCSGYCRSWPHSAYQ---RRTPLTHGSVKTIYV 570
           IL P C   LR C G CR  P S  +   R  PL H  ++ + V
Sbjct: 283 ILDPPCYVELRVCGGQCRRIPRSDLEILPRFVPLQHVEIELVVV 326


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,183,809
Number of Sequences: 37544
Number of extensions: 364027
Number of successful extensions: 888
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 872
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 888
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1756684372
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)