BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0296 (594 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56597| Best HMM Match : COesterase (HMM E-Value=0) 30 1.2 SB_6604| Best HMM Match : Extensin_2 (HMM E-Value=0.27) 27 8.6 >SB_56597| Best HMM Match : COesterase (HMM E-Value=0) Length = 505 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +2 Query: 140 IYILIVFLVFSVCEGSLGLSILVSIIRSHGNDYFQRF 250 I I+I+ ++ + E + LSI+++II +DY Q + Sbjct: 462 IIIIIIIIIIIIIENVINLSIIINIIDVDVDDYLQAY 498 >SB_6604| Best HMM Match : Extensin_2 (HMM E-Value=0.27) Length = 492 Score = 27.5 bits (58), Expect = 8.6 Identities = 18/47 (38%), Positives = 21/47 (44%) Frame = +2 Query: 215 IRSHGNDYFQRFRNYNDKIFIYNNFYNSFMFYKKYILIGSNNIIFYN 355 IR+H D FQ Y +YNN YN+ Y G NN YN Sbjct: 372 IRTHAKDNFQPPYQYGLNNNVYNNGYNNNNGYNSN---GYNNGYNYN 415 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,272,086 Number of Sequences: 59808 Number of extensions: 63623 Number of successful extensions: 163 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 163 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -