BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0295 (775 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 25 0.59 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 5.5 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 5.5 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 25.4 bits (53), Expect = 0.59 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = +2 Query: 515 HNFPYDYRTKQHDNEN*S---NL*CKEIILLTINIKQL 619 +N+ Y+Y ++N N + N CK++ INI+Q+ Sbjct: 327 NNYKYNYNNNNYNNNNYNNNYNNNCKKLYYNIINIEQI 364 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.2 bits (45), Expect = 5.5 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +1 Query: 241 YDRCKHPTWTLYYYLCIYLFGTQYTLQAKKI 333 Y C WT YY+ I + Y L + +I Sbjct: 102 YATCVLSCWTNIYYIIILAWALFYLLVSLRI 132 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.2 bits (45), Expect = 5.5 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +1 Query: 241 YDRCKHPTWTLYYYLCIYLFGTQYTLQAKKI 333 Y C WT YY+ I + Y L + +I Sbjct: 155 YATCVLSCWTNIYYIIILAWALFYLLVSLRI 185 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,714 Number of Sequences: 438 Number of extensions: 4096 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -