BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0294 (779 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 26 1.5 AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding pr... 24 6.1 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 25.8 bits (54), Expect = 1.5 Identities = 13/40 (32%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 520 GMGCVSDHWCSCCWRRD--QHSSIPTCYRSHLEGTAFGGY 633 G+GC + C +D +H HLE TAF Y Sbjct: 130 GLGCNAGQTNRCSSLKDLIKHGETQAVIEIHLENTAFNAY 169 >AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding protein OBPjj5a protein. Length = 272 Score = 23.8 bits (49), Expect = 6.1 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = +3 Query: 612 RNSFWRLQK*RKCTKACR*VLGEEAAFRRICHSQCAAE 725 RN+F + R C A R RR C+ QC E Sbjct: 140 RNNFHLPKSNRNCRTAARRNHSSRNTCRRNCYQQCIYE 177 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 797,835 Number of Sequences: 2352 Number of extensions: 15043 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81497388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -