BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0291 (746 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1... 26 5.0 SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein |S... 26 5.0 >SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 857 Score = 26.2 bits (55), Expect = 5.0 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 3/62 (4%) Frame = +2 Query: 77 PDVGPALVEAPIVPSP--VHVGPLVPG-QLTPLVHILININDAASATPVESVEPEQSNVE 247 P V P + EAP VP P V P VP P V ++ + P V PE +V Sbjct: 592 PPVAPVVPEAPSVPQPPVAPVAPEVPSVPQRPAVPVVPEA-PSVPQPPAAPVVPEVPSVP 650 Query: 248 EK 253 ++ Sbjct: 651 QR 652 >SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 971 Score = 26.2 bits (55), Expect = 5.0 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 86 GPALVEA-PIVPSPVHVGPLVPGQLTPLVHILINI 187 G AL+ PIV S H+ P G+L P +H +++ Sbjct: 781 GAALLSKFPIVNSTHHLLPSPQGELAPAIHATLDV 815 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,971,142 Number of Sequences: 5004 Number of extensions: 30313 Number of successful extensions: 107 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -