BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0290 (553 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3G6.08 |erv1||sulfhydryl oxidase |Schizosaccharomyces pombe|... 27 1.4 SPAC1039.11c ||SPAC922.02c|alpha-glucosidase|Schizosaccharomyces... 26 4.2 SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyce... 25 5.6 SPBC215.15 |sec13||COPII-coated vesicle component Sec13|Schizosa... 25 7.4 >SPAC3G6.08 |erv1||sulfhydryl oxidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 182 Score = 27.5 bits (58), Expect = 1.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 253 SISSWLVHVHNDLNERSG 200 S+ W+ HND+NER G Sbjct: 147 SLCEWICEAHNDVNERLG 164 >SPAC1039.11c ||SPAC922.02c|alpha-glucosidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 995 Score = 25.8 bits (54), Expect = 4.2 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +2 Query: 224 VNVNQPGADAVSFRSPSLLTSPMKSNPTPLL 316 +NV G + + + PSL T K NP LL Sbjct: 853 INVAIRGGNIIPMQKPSLTTHETKQNPYDLL 883 >SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyces pombe|chr 1|||Manual Length = 604 Score = 25.4 bits (53), Expect = 5.6 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 166 PRYRWTSRTRPAHSSRSDHCEREPARS 246 PR + SR+ HSS H R P RS Sbjct: 122 PRSDYGSRSPSPHSSVDSHQSRSPVRS 148 >SPBC215.15 |sec13||COPII-coated vesicle component Sec13|Schizosaccharomyces pombe|chr 2|||Manual Length = 297 Score = 25.0 bits (52), Expect = 7.4 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +2 Query: 221 IVNVNQPGADAVSFRSPSLLTSPMKSNPTPLLSPKRLKKA 340 I ++PG +AV + PSL S + +P PK+L A Sbjct: 140 IFTAHEPGCNAVCWSPPSLSGSVV--GQSPAAGPKKLATA 177 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,893,876 Number of Sequences: 5004 Number of extensions: 33218 Number of successful extensions: 96 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 96 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 229961028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -