BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0290 (553 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M81490-1|AAA28727.1| 449|Drosophila melanogaster neuropeptide r... 28 9.7 BT015303-1|AAT94531.1| 464|Drosophila melanogaster AT16733p pro... 28 9.7 AE014297-4047|AAF56655.3| 464|Drosophila melanogaster CG5811-PA... 28 9.7 >M81490-1|AAA28727.1| 449|Drosophila melanogaster neuropeptide receptor protein. Length = 449 Score = 27.9 bits (59), Expect = 9.7 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +3 Query: 45 CFRCYRSCGCRQPHQAHFRTRNHRFPSSRRWCC 143 C+ C ++ F HR P RRWCC Sbjct: 362 CYNPIIYCYMNARFRSGFVQLMHRMPGLRRWCC 394 >BT015303-1|AAT94531.1| 464|Drosophila melanogaster AT16733p protein. Length = 464 Score = 27.9 bits (59), Expect = 9.7 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +3 Query: 45 CFRCYRSCGCRQPHQAHFRTRNHRFPSSRRWCC 143 C+ C ++ F HR P RRWCC Sbjct: 377 CYNPIIYCYMNARFRSGFVQLMHRMPGLRRWCC 409 >AE014297-4047|AAF56655.3| 464|Drosophila melanogaster CG5811-PA protein. Length = 464 Score = 27.9 bits (59), Expect = 9.7 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +3 Query: 45 CFRCYRSCGCRQPHQAHFRTRNHRFPSSRRWCC 143 C+ C ++ F HR P RRWCC Sbjct: 377 CYNPIIYCYMNARFRSGFVQLMHRMPGLRRWCC 409 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,636,032 Number of Sequences: 53049 Number of extensions: 419776 Number of successful extensions: 1291 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1216 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1291 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2110522698 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -