BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0289 (817 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 23 3.4 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 7.8 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 23.0 bits (47), Expect = 3.4 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = -2 Query: 225 GYDESVEVSSDSFTVIVYREDGAASEGERRSHNRVDRQQQ 106 GY ++ + D TV R S+G R +HN +++ ++ Sbjct: 23 GYASTMPMPDDMRTV-TKRPKTKKSQGSRTTHNELEKNRR 61 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.8 bits (44), Expect = 7.8 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -3 Query: 413 STETKSDNANKLGIVAEGCSQDIDEFSN*ST 321 STET + N L CSQ +SN T Sbjct: 347 STETLNTKCNTLERTPSKCSQTSVHYSNGQT 377 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 213,827 Number of Sequences: 438 Number of extensions: 4649 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25974678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -