BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0186 (625 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical prot... 26 1.1 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 25 2.0 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 24 4.5 AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. 24 4.5 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 24 4.5 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 24 4.5 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 24 4.5 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 24 4.5 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 24 4.5 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 24 4.5 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 24 4.5 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 24 4.5 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 24 4.5 AY278448-1|AAP37005.1| 147|Anopheles gambiae microsomal glutath... 23 7.9 >AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical protein protein. Length = 257 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -1 Query: 424 CMKNCAVNSSSYFLPLVAFSAALVTLPPP 338 C + C+ N S F P V + +PPP Sbjct: 42 CSRKCSRNGSPKFAPAVQSKNRMPPVPPP 70 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 25.0 bits (52), Expect = 2.0 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = -1 Query: 346 PPPASLKLTALMTPTATVCLMSRTAKRPRGGIPGRTLH 233 PPP + T PT T+ TA P P T H Sbjct: 246 PPPTTTTTTVWTDPTTTITTDYTTAYPPTTNEPPSTPH 283 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.8 bits (49), Expect = 4.5 Identities = 9/34 (26%), Positives = 15/34 (44%) Frame = -1 Query: 313 MTPTATVCLMSRTAKRPRGGIPGRTLHIEAWKVP 212 +T T CL + +P T+ + WK+P Sbjct: 510 LTTEYTTCLEFLILPKIATDLPSETMDVRGWKLP 543 >AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. Length = 163 Score = 23.8 bits (49), Expect = 4.5 Identities = 17/73 (23%), Positives = 28/73 (38%) Frame = +1 Query: 67 GYTPVLDCHTAHIACKFAEIKEKVDRRTGKSTEVNPKSIKSGDAAIVNLVPSKPLCVESF 246 G++PV H+A + K T S+ + +KS + + L+ + Sbjct: 77 GHSPVASPHSALSLSPVSVSKFDTSASTSNSSNASVSPVKSLNGSTKGLLLAAAAAAAVN 136 Query: 247 QEFHPSVVLLSVT 285 Q P LL VT Sbjct: 137 QSVCPQTTLLPVT 149 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 4.5 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = -1 Query: 346 PPPASLKLTALMTPTATVCLMSRTAKRPRGGIPGRTLH 233 PPP + T PT T TA P P T H Sbjct: 246 PPPTTTTTTVWTDPTTTTTTDYTTAYPPTTNEPPSTPH 283 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 4.5 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = -1 Query: 346 PPPASLKLTALMTPTATVCLMSRTAKRPRGGIPGRTLH 233 PPP + T PT T TA P P T H Sbjct: 246 PPPTTTTTTVWTDPTTTTTTDYTTAYPPTTNEPPSTPH 283 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.8 bits (49), Expect = 4.5 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = -1 Query: 346 PPPASLKLTALMTPTATVCLMSRTAKRPRGGIPGRTLH 233 PPP + T PT T TA P P T H Sbjct: 245 PPPTTTTTTVWTDPTTTTTTDYTTAYPPTTNEPPSTPH 282 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.8 bits (49), Expect = 4.5 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = -1 Query: 346 PPPASLKLTALMTPTATVCLMSRTAKRPRGGIPGRTLH 233 PPP + T PT T TA P P T H Sbjct: 245 PPPTTTTTTVWTDPTTTTTTDYTTAYPPTTNEPPSTPH 282 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 4.5 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = -1 Query: 346 PPPASLKLTALMTPTATVCLMSRTAKRPRGGIPGRTLH 233 PPP + T PT T TA P P T H Sbjct: 246 PPPTTTTTTVWTDPTTTTTTDYTTAYPPTTNEPPSTPH 283 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 4.5 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = -1 Query: 346 PPPASLKLTALMTPTATVCLMSRTAKRPRGGIPGRTLH 233 PPP + T PT T TA P P T H Sbjct: 246 PPPTTTTTTVWTDPTTTTTTDYTTAYPPTTNEPPSTPH 283 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.8 bits (49), Expect = 4.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 188 LEMQPLSTWYLPSLYV*SP 244 LE PL++W LP YV P Sbjct: 632 LEPVPLASWQLPPPYVTEP 650 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 23.8 bits (49), Expect = 4.5 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = -1 Query: 346 PPPASLKLTALMTPTATVCLMSRTAKRPRGGIPGRTLH 233 PPP + T PT T TA P P T H Sbjct: 246 PPPTTTTTTVWTDPTTTTTTDYTTAYPPTTSEPPSTPH 283 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 23.8 bits (49), Expect = 4.5 Identities = 13/48 (27%), Positives = 20/48 (41%) Frame = -1 Query: 382 PLVAFSAALVTLPPPASLKLTALMTPTATVCLMSRTAKRPRGGIPGRT 239 PL+ +LV P++ + + PT + T P G PG T Sbjct: 390 PLMHEIRSLVNGGTPSTTTMPPSVAPTTSTVAPGTTTTTPTGANPGTT 437 >AY278448-1|AAP37005.1| 147|Anopheles gambiae microsomal glutathione transferase GSTMIC3protein. Length = 147 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +1 Query: 472 YKLIPFLYFLQGCNVTLFYNLYKVI 546 Y +I FLY +VT+ NL++++ Sbjct: 80 YFIIGFLYMFTNPSVTVATNLFRLV 104 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 629,816 Number of Sequences: 2352 Number of extensions: 13731 Number of successful extensions: 57 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -