BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0184 (614 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC336.04 |cdc6|pol3, pold, mis10|DNA polymerase delta catalyti... 26 3.8 SPCC18B5.01c |bfr1|hba2, SPCPJ732.04c|brefeldin A efflux transpo... 26 5.0 SPAC1D4.10 |||tRNA endonuclease|Schizosaccharomyces pombe|chr 1|... 26 5.0 SPAC56F8.12 |||conserved fungal protein|Schizosaccharomyces pomb... 25 6.6 SPAC139.06 |hat1|SPAC23C4.01|histone acetyltransferase Hat1|Schi... 25 8.7 SPAC15E1.10 ||SPAP7G5.01|PI31 proteasome regulator related|Schiz... 25 8.7 SPCC290.02 |rpc34||DNA-directed RNA polymerase III complex subun... 25 8.7 >SPBC336.04 |cdc6|pol3, pold, mis10|DNA polymerase delta catalytic subunit Cdc6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1086 Score = 26.2 bits (55), Expect = 3.8 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -3 Query: 375 WNYCVRCRGHC-QQYVCYSWDE**FCSRYAQH 283 W C RC+G Q +C S D F R A+H Sbjct: 1037 WTQCQRCQGSMHQDVICTSRDCPIFYMRIAEH 1068 >SPCC18B5.01c |bfr1|hba2, SPCPJ732.04c|brefeldin A efflux transporter Bfr1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1530 Score = 25.8 bits (54), Expect = 5.0 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 166 SCGGNILNQRSILSAAHCPYGDA 234 + GN+LN + S ++CPY A Sbjct: 1451 TAAGNLLNPNATTSCSYCPYQTA 1473 >SPAC1D4.10 |||tRNA endonuclease|Schizosaccharomyces pombe|chr 1|||Manual Length = 809 Score = 25.8 bits (54), Expect = 5.0 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 139 TWNWNQWWQSCGG 177 T N+ WW SCGG Sbjct: 114 TVNYPTWWDSCGG 126 >SPAC56F8.12 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 394 Score = 25.4 bits (53), Expect = 6.6 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Frame = +1 Query: 478 RSEGLIRSNSARP----GLDHQSECLRPTLQTH*PC 573 R + R NS R G +H +CL P+ +T PC Sbjct: 336 RRTTISRDNSTRSTWGIGSEHDMQCLPPSYETMGPC 371 >SPAC139.06 |hat1|SPAC23C4.01|histone acetyltransferase Hat1|Schizosaccharomyces pombe|chr 1|||Manual Length = 378 Score = 25.0 bits (52), Expect = 8.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 372 NYCVRCRGHCQQYVCYSWDE 313 +YC+R G+C Y Y WD+ Sbjct: 173 DYCLR--GYCTVYKYYKWDK 190 >SPAC15E1.10 ||SPAP7G5.01|PI31 proteasome regulator related|Schizosaccharomyces pombe|chr 1|||Manual Length = 265 Score = 25.0 bits (52), Expect = 8.7 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +3 Query: 258 GSTFANSGGVVHNVNRIIIHPNYNRR 335 GS N GG++ N I HP R Sbjct: 175 GSDMGNDGGMIPTFNHPIFHPENRSR 200 >SPCC290.02 |rpc34||DNA-directed RNA polymerase III complex subunit Rpc34|Schizosaccharomyces pombe|chr 3|||Manual Length = 301 Score = 25.0 bits (52), Expect = 8.7 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +3 Query: 492 NSEQLRTSRSGPSIRMPASNVTDPLTVLSPLTCCALVFW 608 N+E + P P S++ D + ++P+TC L W Sbjct: 261 NNENIDAFTESPCGNCPVSDICDANSRVNPITCEYLDKW 299 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,722,014 Number of Sequences: 5004 Number of extensions: 59154 Number of successful extensions: 159 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 159 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 269634532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -