BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0184 (614 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0671 - 24164490-24164544,24164920-24165086,24165787-241659... 31 0.96 03_02_0996 - 13082540-13082818,13083107-13083221,13084135-130842... 30 1.7 03_02_0700 - 10517754-10519100 29 2.2 01_05_0302 + 20637139-20637291,20637390-20637476,20637609-206378... 29 2.2 06_01_1145 - 9575173-9575553,9575712-9575858,9575971-9576024,957... 29 2.9 03_05_0373 + 23581812-23583293 29 2.9 01_05_0612 - 23652121-23652400,23653031-23654427 29 3.9 09_02_0234 - 6116931-6117052,6117549-6118369,6118573-6118601,611... 28 5.1 03_02_0741 - 10857656-10857844,10858315-10858848,10859516-108598... 27 8.9 >01_05_0671 - 24164490-24164544,24164920-24165086,24165787-24165941, 24166291-24166458,24167471-24167552 Length = 208 Score = 30.7 bits (66), Expect = 0.96 Identities = 20/49 (40%), Positives = 24/49 (48%), Gaps = 7/49 (14%) Frame = +3 Query: 3 HEAVYHYFVGPW-AC---CCGGCSYQPTKDYWWLHD---QH*PVSRYSC 128 HE +YH+ GPW C C GG Y+ Y L D +H PV SC Sbjct: 83 HE-IYHWVAGPWMKCSSPCDGGVRYRDVACYGNLSDATIKHYPVDDASC 130 >03_02_0996 - 13082540-13082818,13083107-13083221,13084135-13084235, 13084890-13085117,13085789-13086106,13086200-13086484, 13086566-13086913 Length = 557 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/53 (35%), Positives = 26/53 (49%) Frame = +3 Query: 360 LRSNSNIAYNNNVRPINIAGANYNLGDNQVVWAAGWGATSLGGSNSEQLRTSR 518 L S +NN V +I G+N L +N ++ A +G SL N Q TSR Sbjct: 219 LLSGLEHCHNNGVLHRDIKGSNLLLDNNGMLKIADFGLASLFDPNKNQPMTSR 271 >03_02_0700 - 10517754-10519100 Length = 448 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 426 YNLGDNQVVWAAGWGATSLGGSNSEQLRTSRSGP 527 +N GDNQ++ G+ SLG +++R S P Sbjct: 393 FNFGDNQILQMYGFTHKSLGSRKVKRIRNETSNP 426 >01_05_0302 + 20637139-20637291,20637390-20637476,20637609-20637836, 20638014-20638184,20638843-20638896,20639028-20639174, 20639326-20639706 Length = 406 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 64 TNPQRIIGGSTTNINQYPGIAALLYTWNWNQWWQSCGGN 180 TNPQ +IGGS + ++ Y + Y +++ W GGN Sbjct: 251 TNPQFVIGGSLSPVSIY---GSTQYEYDYLVWKDPAGGN 286 >06_01_1145 - 9575173-9575553,9575712-9575858,9575971-9576024, 9576692-9576862,9577004-9577231,9577392-9577478, 9577600-9577761 Length = 409 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +1 Query: 64 TNPQRIIGGSTTNINQYPGIAALLYTWNWNQWWQSCGGN 180 TNPQ +IGGS + ++ Y Y +++ W GGN Sbjct: 254 TNPQFVIGGSISPVSTY---GDTQYEYDYLVWKDPAGGN 289 >03_05_0373 + 23581812-23583293 Length = 493 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -3 Query: 282 PHCWQRWNQPNTPTACSVTVWTVSGTKDRSLV 187 PH W+R +QP TA + W+ T + + V Sbjct: 459 PHVWKREDQPAAATAAAARAWSPYQTSEMNSV 490 >01_05_0612 - 23652121-23652400,23653031-23654427 Length = 558 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = +3 Query: 258 GSTFANSGGVVHNVNRII--IHPNYNRRTADSD 350 G T A S ++R++ +HPN NR+T DSD Sbjct: 64 GITVAFSAAAPPAISRLLFALHPNKNRQTTDSD 96 >09_02_0234 - 6116931-6117052,6117549-6118369,6118573-6118601, 6118711-6119020,6119469-6119476,6120104-6120232, 6120341-6120445 Length = 507 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -2 Query: 589 HVSGDSTVNGSVTL-DAGILIDGPDLDVRSCSELDPPSD 476 H GD+ ++ T D +++ D+D SC DPPS+ Sbjct: 323 HCEGDTDIDDLYTPEDVDVVLGVADMDDMSCELSDPPSE 361 >03_02_0741 - 10857656-10857844,10858315-10858848,10859516-10859824, 10860521-10860622,10861446-10861613,10862734-10862847, 10863003-10863107,10863206-10863336,10863680-10863804, 10863890-10864061,10864411-10864505,10864771-10864841, 10864923-10865009,10865119-10865184,10865401-10865499, 10866631-10866672,10866757-10866822,10866910-10867101, 10867224-10867289,10868473-10868811 Length = 1023 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = -1 Query: 173 PQDCHH*FQFHVYNKAAIPGYWLMLVVEPPIILCGLV 63 P+DCH + ++ PG+++ + V+ P +L LV Sbjct: 108 PEDCHTVIALPLPHQPLFPGFFMAMSVKDPKLLKALV 144 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,975,926 Number of Sequences: 37544 Number of extensions: 442324 Number of successful extensions: 1294 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1258 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1294 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1478421500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -