BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0183 (609 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17C9.10 |stm1||G-protein coupled receptor Stm1|Schizosacchar... 27 2.1 SPBC32H8.02c |nep2|mug120|nedd8 protease Nep2|Schizosaccharomyce... 25 8.7 >SPAC17C9.10 |stm1||G-protein coupled receptor Stm1|Schizosaccharomyces pombe|chr 1|||Manual Length = 271 Score = 27.1 bits (57), Expect = 2.1 Identities = 10/44 (22%), Positives = 26/44 (59%) Frame = -2 Query: 356 LRLHHSQSRDSITLIIIIVHAAFNTSNWIEITKIYSTNFIYYTY 225 ++ H ++S + +++I ++ + NTS I +++++ YTY Sbjct: 198 IKNHKAKSTEGLSIIFFVLASVGNTSYAFSILVFPASDYLNYTY 241 >SPBC32H8.02c |nep2|mug120|nedd8 protease Nep2|Schizosaccharomyces pombe|chr 2|||Manual Length = 415 Score = 25.0 bits (52), Expect = 8.7 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 3/30 (10%) Frame = -1 Query: 405 SFSMLPT---RRPVSGVPPPTTASFSITRQ 325 S S+LPT +RP S VP P TA+ T+Q Sbjct: 381 STSVLPTSILQRPPSIVPRPETAAIQHTQQ 410 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,439,670 Number of Sequences: 5004 Number of extensions: 48586 Number of successful extensions: 93 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 268287866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -