BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0183 (609 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0550 - 23795957-23796154,23796596-23796650,23797324-237973... 28 6.7 05_05_0208 + 23275931-23275996,23276084-23276196,23276279-232764... 27 8.8 >02_04_0550 - 23795957-23796154,23796596-23796650,23797324-23797376, 23797453-23797529,23797613-23797736,23797848-23797964, 23798439-23798547,23798724-23798829,23799043-23799106, 23799214-23799333 Length = 340 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -2 Query: 401 SVCYRLDDQFQASHRLR--LHHSQSRDSITLIIIIVH 297 SVC+RLDD Q S+ R L+ +R+ +T I +H Sbjct: 93 SVCFRLDDDLQRSNEWRESLNPCANRNCLTNICANLH 129 >05_05_0208 + 23275931-23275996,23276084-23276196,23276279-23276459, 23276590-23276674,23276974-23277104,23277194-23277432, 23277512-23277748,23277838-23277992,23278039-23278271, 23278359-23278521,23278613-23278818,23278960-23279019, 23279106-23279198,23279406-23279569,23280070-23280138, 23280241-23280382,23280490-23280546 Length = 797 Score = 27.5 bits (58), Expect = 8.8 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = -2 Query: 398 VCYRLDDQFQASHRLRLHHSQSRDSITLIIIIVHAAFNTSNWIEITKIYSTNFIYYTYD 222 VC D+ R+ +H + ++T+ +HA+ N + I + N IY TYD Sbjct: 428 VCIDEFDKMNDQDRVAIHEVMEQQTVTIAKAGIHASLNA----RCSVIAAANPIYGTYD 482 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,868,987 Number of Sequences: 37544 Number of extensions: 245919 Number of successful extensions: 637 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 636 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1454766756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -