BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0180 (543 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024796-2|AAK29892.2| 446|Caenorhabditis elegans Hypothetical ... 28 3.8 Z49131-5|CAA88978.1| 217|Caenorhabditis elegans Hypothetical pr... 28 5.0 >AC024796-2|AAK29892.2| 446|Caenorhabditis elegans Hypothetical protein Y48G1C.4 protein. Length = 446 Score = 28.3 bits (60), Expect = 3.8 Identities = 10/29 (34%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = -1 Query: 507 WVPHA-GIYSEHSRPMLYKFGSTHFNYKS 424 W HA G+++EH+ ++ GS+++ Y+S Sbjct: 355 WTFHAKGLWAEHNNQLMTLIGSSNYGYRS 383 >Z49131-5|CAA88978.1| 217|Caenorhabditis elegans Hypothetical protein ZC373.6 protein. Length = 217 Score = 27.9 bits (59), Expect = 5.0 Identities = 14/50 (28%), Positives = 21/50 (42%) Frame = +2 Query: 125 TGLDPSARDWENNVLRLGTNDAQYVEVIHTDGSGVNKNGLGVAMDTLTSL 274 TG +P AR E + + E + GSG G G + T+T + Sbjct: 43 TGKEPHARKIEQETEEIKKEELMQAEDVEGSGSGEEIEGSGEVISTITGV 92 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,855,653 Number of Sequences: 27780 Number of extensions: 273642 Number of successful extensions: 648 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 617 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 648 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1091917214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -