BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0179 (765 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|c... 29 0.73 SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces ... 26 5.1 SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|ch... 26 6.8 SPBP8B7.09c |||karyopherin|Schizosaccharomyces pombe|chr 2|||Manual 25 9.0 SPBC26H8.10 |dis3|rrp44|3'-5' exoribonuclease subunit Dis3 |Schi... 25 9.0 >SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 288 Score = 29.1 bits (62), Expect = 0.73 Identities = 11/30 (36%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = -3 Query: 199 YFVGFQN-SEVMINRDNWGHSYCDVRGEIL 113 Y VG+ N + ++++ WGHS+ +V E+L Sbjct: 142 YIVGYPNEARLLMDNFKWGHSFFEVNEELL 171 >SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces pombe|chr 1|||Manual Length = 345 Score = 26.2 bits (55), Expect = 5.1 Identities = 13/57 (22%), Positives = 25/57 (43%) Frame = +2 Query: 122 TSNVAIRMPPVIPINHYLGVLKTNKIEPRSYSIIPCTKYSSSIFTRFEHSNLFKVKL 292 T +++ +P + G+ +P I C KY S+ ++ HS L ++L Sbjct: 208 TRKFLVKLAKALPDAKFFGIFDW---DPHGLCIYSCFKYGSNAYSHEPHSQLRNLQL 261 >SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 845 Score = 25.8 bits (54), Expect = 6.8 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = +1 Query: 556 LIPITRPRKSPVSLFFVTTSPCREWVICA 642 +IPI + KS +SL F+T SPC + IC+ Sbjct: 45 IIPIAQ--KSNISLPFLTLSPC-SFTICS 70 >SPBP8B7.09c |||karyopherin|Schizosaccharomyces pombe|chr 2|||Manual Length = 978 Score = 25.4 bits (53), Expect = 9.0 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -3 Query: 154 NWGHSYCDVRGEILGSSQDEHQXKHLPKVFSSIKNE 47 NW + ++G I SSQ E +L KV SI +E Sbjct: 123 NWNDFFASLQGVIAASSQSEFSNFYL-KVLLSIGDE 157 >SPBC26H8.10 |dis3|rrp44|3'-5' exoribonuclease subunit Dis3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 970 Score = 25.4 bits (53), Expect = 9.0 Identities = 12/42 (28%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +3 Query: 294 RPTSLTEEHRDRILI-LNRRFLERRLTDDMLRKRVSITADAC 416 RP S + HRDR+ + R +++ + + LR + + AC Sbjct: 9 RPQSSEKNHRDRVFVRATRGKVQKVVREQYLRNDIPCQSRAC 50 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,985,338 Number of Sequences: 5004 Number of extensions: 59745 Number of successful extensions: 164 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 161 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 163 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 367316502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -