BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0176 (829 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y15061-1|CAA75345.1| 378|Homo sapiens GalT4 protein protein. 30 8.9 CR457093-1|CAG33374.1| 378|Homo sapiens B3GALT4 protein. 30 8.9 BC032574-1|AAH32574.1| 378|Homo sapiens UDP-Gal:betaGlcNAc beta... 30 8.9 AL844527-18|CAI41849.1| 378|Homo sapiens UDP-Gal:betaGlcNAc bet... 30 8.9 AL662827-1|CAI17515.1| 378|Homo sapiens UDP-Gal:betaGlcNAc beta... 30 8.9 AL662820-1|CAI18111.1| 378|Homo sapiens UDP-Gal:betaGlcNAc beta... 30 8.9 AL031228-1|CAA20230.1| 378|Homo sapiens UDP-Gal:betaGlcNAc beta... 30 8.9 AB026730-1|BAA88988.1| 378|Homo sapiens beta-1,3-galactosyltran... 30 8.9 >Y15061-1|CAA75345.1| 378|Homo sapiens GalT4 protein protein. Length = 378 Score = 30.3 bits (65), Expect = 8.9 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 39 WEHLPTALIPETEMCFSGGAVVHGDDLVLLYTGRVTTDTDP 161 W + P+ E GG V+H +++ LLY GRV +P Sbjct: 196 WGQWERSTEPQREAEQEGGQVLHSEEVPLLYLGRVHWRVNP 236 >CR457093-1|CAG33374.1| 378|Homo sapiens B3GALT4 protein. Length = 378 Score = 30.3 bits (65), Expect = 8.9 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 39 WEHLPTALIPETEMCFSGGAVVHGDDLVLLYTGRVTTDTDP 161 W + P+ E GG V+H +++ LLY GRV +P Sbjct: 196 WGQWERSTEPQREAEQEGGQVLHSEEVPLLYLGRVHWRVNP 236 >BC032574-1|AAH32574.1| 378|Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4 protein. Length = 378 Score = 30.3 bits (65), Expect = 8.9 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 39 WEHLPTALIPETEMCFSGGAVVHGDDLVLLYTGRVTTDTDP 161 W + P+ E GG V+H +++ LLY GRV +P Sbjct: 196 WGQWERSTEPQREAEQEGGQVLHSEEVPLLYLGRVHWRVNP 236 >AL844527-18|CAI41849.1| 378|Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4 protein. Length = 378 Score = 30.3 bits (65), Expect = 8.9 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 39 WEHLPTALIPETEMCFSGGAVVHGDDLVLLYTGRVTTDTDP 161 W + P+ E GG V+H +++ LLY GRV +P Sbjct: 196 WGQWERSTEPQREAEQEGGQVLHSEEVPLLYLGRVHWRVNP 236 >AL662827-1|CAI17515.1| 378|Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4 protein. Length = 378 Score = 30.3 bits (65), Expect = 8.9 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 39 WEHLPTALIPETEMCFSGGAVVHGDDLVLLYTGRVTTDTDP 161 W + P+ E GG V+H +++ LLY GRV +P Sbjct: 196 WGQWERSTEPQREAEQEGGQVLHSEEVPLLYLGRVHWRVNP 236 >AL662820-1|CAI18111.1| 378|Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4 protein. Length = 378 Score = 30.3 bits (65), Expect = 8.9 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 39 WEHLPTALIPETEMCFSGGAVVHGDDLVLLYTGRVTTDTDP 161 W + P+ E GG V+H +++ LLY GRV +P Sbjct: 196 WGQWERSTEPQREAEQEGGQVLHSEEVPLLYLGRVHWRVNP 236 >AL031228-1|CAA20230.1| 378|Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4 protein. Length = 378 Score = 30.3 bits (65), Expect = 8.9 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 39 WEHLPTALIPETEMCFSGGAVVHGDDLVLLYTGRVTTDTDP 161 W + P+ E GG V+H +++ LLY GRV +P Sbjct: 196 WGQWERSTEPQREAEQEGGQVLHSEEVPLLYLGRVHWRVNP 236 >AB026730-1|BAA88988.1| 378|Homo sapiens beta-1,3-galactosyltransferase-4 protein. Length = 378 Score = 30.3 bits (65), Expect = 8.9 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 39 WEHLPTALIPETEMCFSGGAVVHGDDLVLLYTGRVTTDTDP 161 W + P+ E GG V+H +++ LLY GRV +P Sbjct: 196 WGQWERSTEPQREAEQEGGQVLHSEEVPLLYLGRVHWRVNP 236 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,422,100 Number of Sequences: 237096 Number of extensions: 2645390 Number of successful extensions: 9699 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9275 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9696 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10370898348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -