BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0176 (829 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 24 1.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 4.6 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 4.6 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 8.0 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 8.0 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 24.2 bits (50), Expect = 1.5 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +1 Query: 202 ELTSASMKEIQSSPTCPTFS*FQRPQDLEIQ 294 EL AS+ + P CP F P D I+ Sbjct: 553 ELHRASLSKTPQPPQCPRFRKLDSPSDSGIE 583 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.6 bits (46), Expect = 4.6 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 616 FYATQTIQGDGKTYLI 663 FY ++QGDGK +L+ Sbjct: 173 FYIYPSLQGDGKFHLL 188 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.6 bits (46), Expect = 4.6 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 616 FYATQTIQGDGKTYLI 663 FY ++QGDGK +L+ Sbjct: 173 FYIYPSLQGDGKFHLL 188 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.8 bits (44), Expect = 8.0 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -3 Query: 773 VHGDRV-PISCSSLTSVVVPAQPSSFSRCGTSHILNQP 663 V DR P+ ++ +QPS +SHIL QP Sbjct: 416 VSPDRTSPMEYRLYNPALIQSQPSPQYPSTSSHILQQP 453 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.8 bits (44), Expect = 8.0 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +3 Query: 129 YTGRVTTDTDPFYNETQY 182 Y + +T+T P YN+ Y Sbjct: 530 YDSKSSTETPPSYNQLNY 547 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 230,932 Number of Sequences: 438 Number of extensions: 5093 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26460186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -