BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0174 (819 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 29 0.17 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 4.9 AY146718-1|AAO12078.1| 149|Anopheles gambiae odorant-binding pr... 23 8.6 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 8.6 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 8.6 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 23 8.6 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 29.1 bits (62), Expect = 0.17 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 347 YNLQLRFRAYSHCRTWSRWTHRWY 418 Y+L+ RAY H T+ RW W+ Sbjct: 1000 YDLEPELRAYLHTNTYVRWGDPWF 1023 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.2 bits (50), Expect = 4.9 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = +2 Query: 512 DDANIVEVLH-TTAGLIGYDY 571 DDANI ++LH TT GL Y + Sbjct: 239 DDANINDLLHFTTKGLTMYRF 259 >AY146718-1|AAO12078.1| 149|Anopheles gambiae odorant-binding protein AgamOBP13 protein. Length = 149 Score = 23.4 bits (48), Expect = 8.6 Identities = 9/40 (22%), Positives = 20/40 (50%) Frame = -3 Query: 688 CLPDRFGVENIGVRMGAGIVQASALTATAGGIKVEISQRI 569 C+ ++FGV N G ++ + + K+E+++ I Sbjct: 74 CMQEQFGVSNGKAFQEDGFIEIAKMLMKGDETKIELAKEI 113 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.4 bits (48), Expect = 8.6 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -1 Query: 156 DGAASEGERRSHNR 115 DGA SEG R SH++ Sbjct: 1028 DGAPSEGRRLSHSK 1041 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.4 bits (48), Expect = 8.6 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = -3 Query: 784 STENAFSGPEHLSCEL--LRSYCKHSDEL 704 ST N +S P+HL C L LRS S+ L Sbjct: 179 STNNIWSLPDHLFCSLSGLRSLNISSNRL 207 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 23.4 bits (48), Expect = 8.6 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +3 Query: 426 RNSNQPIPHIIALDPSLH 479 RNS +P+ H++ L+ L+ Sbjct: 175 RNSTEPVEHVLHLEEELY 192 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 818,881 Number of Sequences: 2352 Number of extensions: 16152 Number of successful extensions: 38 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86902827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -