BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0166 (580 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 22 3.3 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 7.6 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 22.2 bits (45), Expect = 3.3 Identities = 7/31 (22%), Positives = 20/31 (64%) Frame = +1 Query: 484 YSLYLYSYINMVNIFKVYIDFMLVHLVSIYY 576 ++ Y+Y++ ++ F + DF+ + +V+I + Sbjct: 64 FNSYMYAFTHIFFFFAICCDFIALIVVNIVH 94 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.0 bits (42), Expect = 7.6 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -3 Query: 332 IEGIKFIIPLLIYKLRLCKRS*LILA 255 I+G F+I L+Y L C + LA Sbjct: 296 IDGPVFVILTLLYSLNSCVNPWIYLA 321 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,290 Number of Sequences: 336 Number of extensions: 1532 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14412858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -