BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0161 (631 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor prot... 24 1.4 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 1.9 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 23 1.9 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 2.4 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 22 4.3 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 22 5.7 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 5.7 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 5.7 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 9.9 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 9.9 >S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor protein. Length = 85 Score = 23.8 bits (49), Expect = 1.4 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -2 Query: 393 WAEVDGMCYSYDAHILVVILLREFGMV-NSKVNIRYFTG 280 W + G C S HI++V L EFG++ + K++ ++ G Sbjct: 46 WFKAIGTCGS---HIIIVGLFYEFGLITHVKLSSDWYMG 81 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 23.4 bits (48), Expect = 1.9 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 188 YHYLSTATCFHGEFYD-PAYRRITLDLPVAVSPVKYLMFTLLLTIPN 325 + +LS+ + + Y+ P Y ++TLD V P+ M+ TIPN Sbjct: 621 FFFLSSMDESNTKSYEIPLYGKMTLDDKVFGFPLDRPMWAWNFTIPN 667 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 23.4 bits (48), Expect = 1.9 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 188 YHYLSTATCFHGEFYD-PAYRRITLDLPVAVSPVKYLMFTLLLTIPN 325 + +LS+ + + Y+ P Y ++TLD V P+ M+ TIPN Sbjct: 621 FFFLSSMDESNTKSYEIPLYGKMTLDDKVFGFPLDRPMWAWNFTIPN 667 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.0 bits (47), Expect = 2.4 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 366 SNTCHPLRPKHPAGCHYP-TRCRNTPGYF 449 S++C P H Y T CR PGYF Sbjct: 276 SHSCEAC-PAHSKSSDYGFTECRCDPGYF 303 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 22.2 bits (45), Expect = 4.3 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 203 LKGSGSW*EQYQRTVGTIDSR 141 +K SG W +Y R + D R Sbjct: 288 VKNSGQWLREYDRELEDFDGR 308 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 21.8 bits (44), Expect = 5.7 Identities = 7/25 (28%), Positives = 13/25 (52%) Frame = -3 Query: 419 WIMAPCWMFGPKWMACVTRTMLTSL 345 W++ PC F W C+ ++ +L Sbjct: 79 WVIHPCSSFRFYWDLCMLLLLVANL 103 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.8 bits (44), Expect = 5.7 Identities = 7/25 (28%), Positives = 13/25 (52%) Frame = -3 Query: 419 WIMAPCWMFGPKWMACVTRTMLTSL 345 W++ PC F W C+ ++ +L Sbjct: 79 WVIHPCSSFRFYWDLCMLLLLVANL 103 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.8 bits (44), Expect = 5.7 Identities = 7/25 (28%), Positives = 13/25 (52%) Frame = -3 Query: 419 WIMAPCWMFGPKWMACVTRTMLTSL 345 W++ PC F W C+ ++ +L Sbjct: 79 WVIHPCSSFRFYWDLCMLLLLVANL 103 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.0 bits (42), Expect = 9.9 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -3 Query: 575 RDHDPCLFPAVF 540 R+HDP FP F Sbjct: 400 REHDPAKFPPSF 411 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.0 bits (42), Expect = 9.9 Identities = 11/38 (28%), Positives = 15/38 (39%) Frame = +1 Query: 229 LRSCIPSHYAGSSRRSEPGEISYVHFAVNHPEFSEENY 342 + S PS+ G S P S +V+ ENY Sbjct: 76 ITSTSPSYPGGGSSSPSPSSPSSFFSSVSPTSLGSENY 113 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,727 Number of Sequences: 438 Number of extensions: 4805 Number of successful extensions: 12 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18826962 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -