BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0160 (480 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 31 0.027 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 25 1.3 EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. 23 4.1 AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 23 5.4 DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasm... 23 7.2 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 7.2 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 22 9.5 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 30.7 bits (66), Expect = 0.027 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 374 YNLQLRFRAYSHCRTWSRWTHRWYRS*KFKPPIPH 478 Y+L+ RAY H T+ RW W+ K + +PH Sbjct: 1000 YDLEPELRAYLHTNTYVRWGDPWFWD-KLRFAMPH 1033 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 25.0 bits (52), Expect = 1.3 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -1 Query: 183 DGAASEGERISHNR 142 DGA SEG R+SH++ Sbjct: 1028 DGAPSEGRRLSHSK 1041 >EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. Length = 399 Score = 23.4 bits (48), Expect = 4.1 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = -2 Query: 413 DNANKLGIVAEGCSQDIDELSN*STALTSVGXXLGV*FRSRTPVDGDYVYI 261 D+ + LG + + +DE + A+TSVG V ++ VD +++I Sbjct: 331 DHKSMLGALKQSTFVQVDENGTEAAAVTSVGTKFRV-RNTQFRVDRPFIFI 380 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 23.0 bits (47), Expect = 5.4 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 217 GNFNAFVIPAHLAL 258 G FN FVIPA +A+ Sbjct: 75 GGFNMFVIPAVMAI 88 >DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasmic carbonic anhydrase protein. Length = 276 Score = 22.6 bits (46), Expect = 7.2 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 112 PEGFPDERGEIQHPV 68 PE FP RG+ Q PV Sbjct: 17 PEMFPQARGQRQSPV 31 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/44 (25%), Positives = 18/44 (40%) Frame = -1 Query: 168 EGERISHNRVDRQQQRXTDLRASPMKEVKYNIPFSQIETVRCSS 37 EGE++ N + R + M E Y + ++ V C S Sbjct: 3095 EGEQVHDNTIQRYKSHYKRTSKHSMIENCYPVTHGELNYVNCYS 3138 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 22.2 bits (45), Expect = 9.5 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = -1 Query: 249 VSGYDESVEVSSDSFTVIVYREDGAASEGERISHNRVD 136 VSGYD S +SS V E+ AS SH D Sbjct: 563 VSGYDSSTSISS----VCSGPEEDNASHSSASSHGSSD 596 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 467,803 Number of Sequences: 2352 Number of extensions: 8206 Number of successful extensions: 23 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 41863041 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -