BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0154 (759 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein p... 27 0.63 AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal ... 25 1.9 >AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein protein. Length = 285 Score = 27.1 bits (57), Expect = 0.63 Identities = 12/40 (30%), Positives = 15/40 (37%) Frame = +1 Query: 400 LHHKLSCPTCKGYS**L*NC*GLDDYCSCHNCYTENFDGP 519 L + C C Y C G D CH C + +GP Sbjct: 208 LERRRQCYRCYEYGHTAARCHGKDRSSKCHRCAEDKHEGP 247 >AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal carrier protein TOL-2 protein. Length = 248 Score = 25.4 bits (53), Expect = 1.9 Identities = 15/54 (27%), Positives = 28/54 (51%) Frame = -2 Query: 179 ENGNFVTVNNKESILNLNTALKTAMGGIILEKINHIVKTDERVIYSDHLSSLFN 18 E + +T+ N + ++ N AL+ G ++N I T + + HL++LFN Sbjct: 138 EGTSNMTMVNCDFLMKWNGALEKRANGKEYYQMNKIKATFDTTRFYMHLTNLFN 191 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 786,885 Number of Sequences: 2352 Number of extensions: 15764 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -