BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0154 (759 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 22 5.4 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 5.4 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 22 5.4 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 7.2 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 22 7.2 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -2 Query: 176 NGNFVTVNNKESILNLNTALKTAMGGIILEKI 81 N N E +LN+ + +T GI EK+ Sbjct: 476 NNNMAATYMNECLLNIQKSPRTLTLGIFAEKL 507 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = +3 Query: 567 SCLYWCCQSCG 599 SC WCC + G Sbjct: 10 SCCCWCCDNLG 20 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 22.2 bits (45), Expect = 5.4 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = +3 Query: 189 DPKAIPWGKAGAEYVVESTGVFPLQIKHLLTWREVLKKLLYQL 317 +P IP + +E++ ++TG LLT R+ L L +++ Sbjct: 273 EPHRIPQLQEVSEFLKKNTGFTLRPAAGLLTSRDFLSSLAFRV 315 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.8 bits (44), Expect = 7.2 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 179 ENGNFVTVNNKESILNLNTALKTAMG 102 ENG +N S L ++ L+TAMG Sbjct: 171 ENGKEFDCHNYMSELTVDILLETAMG 196 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.8 bits (44), Expect = 7.2 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +3 Query: 579 WCCQSCG*GYPCS 617 + C++CG G+ CS Sbjct: 204 YVCKACGKGFTCS 216 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,065 Number of Sequences: 438 Number of extensions: 4400 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -