BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0147 (708 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pomb... 30 0.28 SPAC26A3.12c |dhp1||5'-3' exoribonuclease Dhp1 |Schizosaccharomy... 26 6.1 >SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 2685 Score = 30.3 bits (65), Expect = 0.28 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = +2 Query: 302 NTNPSKSRASQNLPPDRKCDPLRRSGEKLSGHQSNCEITPSLIALVYNFRT 454 + N S S NL P P ++ G L+ + E+TP I+ +YN++T Sbjct: 1511 SNNMSYPLRSGNLFPTLDSSPNKKFGRHLATFKYALELTPLFISHMYNYKT 1561 >SPAC26A3.12c |dhp1||5'-3' exoribonuclease Dhp1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 991 Score = 25.8 bits (54), Expect = 6.1 Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Frame = +2 Query: 362 PLRRSGEKLSGHQSNCEI--TPSLIALVYNFRTYVLKTLKTGESQHSVTFVLT 514 P+ + K SNC TP + L + R Y++ L + +V F+L+ Sbjct: 146 PIDENATKKKSWDSNCITPGTPFMDTLAKSLRYYIINKLNSDPCWRNVRFILS 198 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,542,677 Number of Sequences: 5004 Number of extensions: 44615 Number of successful extensions: 117 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -