BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0147 (708 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 23 2.8 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 3.7 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 23.0 bits (47), Expect = 2.8 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = +2 Query: 287 PDDDANTNPSKSRASQNLPPDRKCDPLRRSGEKLSGHQSNCEITPSLI 430 PD +PS + PP+ + P+ +S L HQ + +P L+ Sbjct: 43 PDHYERFSPSTHLMDLSSPPEHRDLPIYQSHHHLHHHQVLYQQSPYLM 90 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 331 RSTALARVRVSIVIRFE 281 RSTA ARVR+ +V + E Sbjct: 311 RSTAQARVRMQVVSQLE 327 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,700 Number of Sequences: 438 Number of extensions: 3225 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -