Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= mg--0138
         (524 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain tran...    22   2.9  
AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia or...    22   2.9  
AM292368-1|CAL23180.2|  387|Tribolium castaneum gustatory recept...    21   6.7  
AM292347-1|CAL23159.2|  387|Tribolium castaneum gustatory recept...    21   6.7  
AM292327-1|CAL23139.2|  387|Tribolium castaneum gustatory recept...    21   6.7  

>AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain
           transcription factor Maxillopediaprotein.
          Length = 523

 Score = 22.2 bits (45), Expect = 2.9
 Identities = 16/70 (22%), Positives = 27/70 (38%)
 Frame = -2

Query: 262 QPRHGGHDGHVTDEHWARGHNGRVSHDHGGHQGHVTNVHWARGHNGGVSHDHRGYTRSLG 83
           Q   G H  +    +   G  G V+H    H GH     + +  N  +   +  Y+  +G
Sbjct: 379 QGYQGEHPNYNHYGYHYSGDGGEVAHLPNTHMGHEPGAAYYQNEN--MLQKNAEYSGKVG 436

Query: 82  NNYRARYYDG 53
             Y   +Y+G
Sbjct: 437 -YYENNHYNG 445


>AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 471

 Score = 22.2 bits (45), Expect = 2.9
 Identities = 16/70 (22%), Positives = 27/70 (38%)
 Frame = -2

Query: 262 QPRHGGHDGHVTDEHWARGHNGRVSHDHGGHQGHVTNVHWARGHNGGVSHDHRGYTRSLG 83
           Q   G H  +    +   G  G V+H    H GH     + +  N  +   +  Y+  +G
Sbjct: 327 QGYQGEHPNYNHYGYHYSGDGGEVAHLPNTHMGHEPGAAYYQNEN--MLQKNAEYSGKVG 384

Query: 82  NNYRARYYDG 53
             Y   +Y+G
Sbjct: 385 -YYENNHYNG 393


>AM292368-1|CAL23180.2|  387|Tribolium castaneum gustatory receptor
           candidate 47 protein.
          Length = 387

 Score = 21.0 bits (42), Expect = 6.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -2

Query: 241 DGHVTDEH 218
           DGHV DEH
Sbjct: 42  DGHVIDEH 49


>AM292347-1|CAL23159.2|  387|Tribolium castaneum gustatory receptor
           candidate 26 protein.
          Length = 387

 Score = 21.0 bits (42), Expect = 6.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -2

Query: 241 DGHVTDEH 218
           DGHV DEH
Sbjct: 42  DGHVIDEH 49


>AM292327-1|CAL23139.2|  387|Tribolium castaneum gustatory receptor
           candidate 6 protein.
          Length = 387

 Score = 21.0 bits (42), Expect = 6.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -2

Query: 241 DGHVTDEH 218
           DGHV DEH
Sbjct: 42  DGHVIDEH 49


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 89,473
Number of Sequences: 336
Number of extensions: 1491
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 12678017
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)