BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0136 (707 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 23 1.8 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 22 5.6 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -1 Query: 482 SIIIKLPDYKHQYL 441 S++IKL DY HQ L Sbjct: 127 SLVIKLVDYHHQLL 140 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 21.8 bits (44), Expect = 5.6 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -3 Query: 528 N*IEDFLTPTCRMYHQYNN*ITGL*TPIFGLKIGV 424 N + DF+ YH + TGL P++G + V Sbjct: 191 NKVVDFINIMSYDYHTADQPQTGLNAPLYGNSMSV 225 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,053 Number of Sequences: 336 Number of extensions: 3081 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18738900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -