BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0136 (707 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP8B7.16c |dbp2||ATP-dependent RNA helicase Dbp2|Schizosacchar... 29 0.86 SPBC4.03c |||COPII-coated vesicle component Sfb3 |Schizosaccharo... 26 6.1 >SPBP8B7.16c |dbp2||ATP-dependent RNA helicase Dbp2|Schizosaccharomyces pombe|chr 2|||Manual Length = 550 Score = 28.7 bits (61), Expect = 0.86 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +1 Query: 484 VIHTTCWR*EIFNLVLNNLSTSKQLTVGSLDIVQSVQMEQYFQI 615 V+ + W E+ L + L+ Q+TVGSLD+ S ++Q ++ Sbjct: 304 VMFSATWPKEVQRLARDYLNDYIQVTVGSLDLAASHNIKQIVEV 347 >SPBC4.03c |||COPII-coated vesicle component Sfb3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 891 Score = 25.8 bits (54), Expect = 6.1 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = +3 Query: 480 TGDTYDMLALRNLQFSFKQSFHIKTTHSRFSRHRTECSNGAVFSNNV 620 T DT + +RNL S + F H + R + S G +FS V Sbjct: 818 TLDTVLSVQVRNLLSSLRMQFPSMALHPQIVRQGLDGSEGEIFSTLV 864 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,542,284 Number of Sequences: 5004 Number of extensions: 47862 Number of successful extensions: 85 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -