BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0136 (707 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0730 + 22614601-22614775,22615073-22615380 32 0.51 12_02_0733 + 22629187-22629277,22630144-22630445 28 8.4 >12_02_0730 + 22614601-22614775,22615073-22615380 Length = 160 Score = 31.9 bits (69), Expect = 0.51 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = -3 Query: 345 SCLAEVTVHYKLLKIKTIFP*RQLLSLNKYLGMLK 241 SCLA++ V Y+L ++ P ++ L L+ Y GMLK Sbjct: 112 SCLAKINVEYELEDGGSLSPEKEKLILDGYFGMLK 146 >12_02_0733 + 22629187-22629277,22630144-22630445 Length = 130 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = -3 Query: 345 SCLAEVTVHYKLLKIKTIFP*RQLLSLNKYLGMLK 241 SC+A++ V Y+L ++ P ++ ++ Y GMLK Sbjct: 82 SCVAKLKVEYELADGSSLSPEQEKTMVDGYFGMLK 116 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,562,230 Number of Sequences: 37544 Number of extensions: 221009 Number of successful extensions: 296 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 296 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1827423340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -