BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0130 (743 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 26 1.1 AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal ... 26 1.1 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 26 1.1 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 25 1.9 Y17700-1|CAA76820.1| 122|Anopheles gambiae hypothetical protein... 24 5.7 DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. 23 7.5 AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 pr... 23 7.5 AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 pr... 23 7.5 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 23 10.0 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 10.0 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 26.2 bits (55), Expect = 1.1 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +1 Query: 316 GSERPQDAAENADFSFSGTD*C*NSGN 396 GSE+P++A E + + SGTD +SG+ Sbjct: 1348 GSEKPKNAIEPSQEAVSGTDNANDSGD 1374 >AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal carrier protein AP-1 protein. Length = 171 Score = 26.2 bits (55), Expect = 1.1 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = +2 Query: 443 KCRELKSSALTSVTRPEKLMMSMHPEGSRSQRTVTAERIS-RSQQFTDFIE 592 KC +K+S V + + + P G + +TVT E + QQF + E Sbjct: 68 KCVIVKNSTKDDVNKVQVTRECLDPAGKATAKTVTTEASNFPGQQFESYAE 118 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 26.2 bits (55), Expect = 1.1 Identities = 19/55 (34%), Positives = 27/55 (49%) Frame = +2 Query: 164 WSNFASEEIDLEVRFDIANSYCSSDVTDNDVSARETEAVASATTFSRASPPEAKD 328 W A EE++ E R IA + TD D+SA + +A + T RAS + D Sbjct: 296 WCTPAIEELENECR--IAEQRQLASPTDPDISALDRQARHALKTAIRASKKQFFD 348 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 25.4 bits (53), Expect = 1.9 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 119 LRSRGQPCSGVRRPTRHQQITVNYSNDTCESK 24 L + P G RRPT++QQI +++D E++ Sbjct: 16 LANEFNPNRGRRRPTKNQQIYGVWADDDSENE 47 >Y17700-1|CAA76820.1| 122|Anopheles gambiae hypothetical protein protein. Length = 122 Score = 23.8 bits (49), Expect = 5.7 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 160 VNNFLEKIPVYLTDYAAEVS 101 VN EK+P YL++ +A V+ Sbjct: 88 VNAIYEKLPAYLSEVSARVN 107 >DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. Length = 304 Score = 23.4 bits (48), Expect = 7.5 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -3 Query: 345 FSRVLRSFASGGLALENVVAEATASVSLADTSLSVTSE 232 +S V + AS ALEN EA S ++ D LSV + Sbjct: 99 YSVVDKVLASRRSALENEFYEANDSPAMLDRLLSVNED 136 >AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 23.4 bits (48), Expect = 7.5 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +2 Query: 74 ELGDVLQNTADLGCVVRQVDRDLL*EVVDGWSNFASEEIDLEV 202 +LGD +N D+G R DL+ E + +N + EEI EV Sbjct: 1 DLGDNDEN--DIGEKRRLAFLDLMIETANNGANISDEEIKEEV 41 >AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 23.4 bits (48), Expect = 7.5 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +2 Query: 74 ELGDVLQNTADLGCVVRQVDRDLL*EVVDGWSNFASEEIDLEV 202 +LGD +N D+G R DL+ E + +N + EEI EV Sbjct: 1 DLGDNDEN--DIGEKRRLAFLDLMIETANNGANISDEEIKEEV 41 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.0 bits (47), Expect = 10.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 440 RKCRELKSSALTSVTRPEK 496 R C ELKSS + +TR E+ Sbjct: 760 RMCWELKSSTIVMMTRLEE 778 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 274 SGSLSNDVLKGKSSGSERPQDAAENADFSFSGTD 375 S ++ ND +K +SGS + Q E F F D Sbjct: 1270 SVTIKNDPMK--TSGSTQQQQQMERQQFGFGNND 1301 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 693,156 Number of Sequences: 2352 Number of extensions: 13808 Number of successful extensions: 71 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -