BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0128 (769 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 24 1.5 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 24 1.5 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 6.2 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 22 6.2 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 6.2 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.2 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 23.8 bits (49), Expect = 1.5 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +2 Query: 458 LFSVTGENISFAISIDIQFYLRVTSSATSEDINLDYF 568 L S T +I D Y + A EDIN+DYF Sbjct: 102 LSSATQASIEIDSLFDGIDYSTTITRARFEDINMDYF 138 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 23.8 bits (49), Expect = 1.5 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +2 Query: 458 LFSVTGENISFAISIDIQFYLRVTSSATSEDINLDYF 568 L S T +I D Y + A EDIN+DYF Sbjct: 102 LSSATQASIEIDSLFDGIDYSTTITRARFEDINMDYF 138 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.8 bits (44), Expect = 6.2 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +3 Query: 660 GYSVPVSCGVKVNWLES 710 GY P S +K++W++S Sbjct: 344 GYEDPESVQIKMDWIKS 360 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 21.8 bits (44), Expect = 6.2 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 232 APKPYARWTRYRRRPSLCASSDSDNEHRGS 143 AP+ +R T+ S +S+D D+E R S Sbjct: 122 APRTASRETKSSESDSGASSADPDDELRSS 151 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.8 bits (44), Expect = 6.2 Identities = 17/62 (27%), Positives = 25/62 (40%) Frame = +2 Query: 113 EHTPLPSPVLRASMLII*V*RRAQGWSSPVAGPPCIGFRSTLPLLYINLFPARFHISPDR 292 E +P P+P A+ + + G +SP A PP S P + A HI R Sbjct: 8 EESPPPAPQSAATPI------SSSGMTSPAAAPPPATTSSGSPASVASNASAPLHIPAKR 61 Query: 293 CS 298 + Sbjct: 62 AA 63 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 196 RRPSLCASSDSDNEHRGS 143 RR S+ ASS D+ H G+ Sbjct: 1163 RRRSMSASSRGDHHHLGA 1180 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 196 RRPSLCASSDSDNEHRGS 143 RR S+ ASS D+ H G+ Sbjct: 1163 RRRSMSASSRGDHHHLGA 1180 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 196 RRPSLCASSDSDNEHRGS 143 RR S+ ASS D+ H G+ Sbjct: 1163 RRRSMSASSRGDHHHLGA 1180 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 196 RRPSLCASSDSDNEHRGS 143 RR S+ ASS D+ H G+ Sbjct: 1163 RRRSMSASSRGDHHHLGA 1180 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,646 Number of Sequences: 336 Number of extensions: 4280 Number of successful extensions: 19 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20650031 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -