BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0124 (519 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g25360.1 68417.m03649 expressed protein 34 0.066 At3g17950.1 68416.m02285 expressed protein ; expression supporte... 28 4.3 At5g45730.1 68418.m05622 DC1 domain-containing protein contains ... 27 5.7 At4g31570.1 68417.m04483 expressed protein 27 5.7 At4g16835.1 68417.m02541 pentatricopeptide (PPR) repeat-containi... 27 5.7 >At4g25360.1 68417.m03649 expressed protein Length = 533 Score = 33.9 bits (74), Expect = 0.066 Identities = 14/39 (35%), Positives = 25/39 (64%) Frame = +2 Query: 71 QLHLSLSLNSVAASIDAAEGEVQIFDRKLTADASGGIAV 187 Q+H+ LSL++ +I ++ FD+ LT+D+S G+ V Sbjct: 63 QVHVPLSLSNHTVNILQKSSDINAFDKNLTSDSSSGLPV 101 >At3g17950.1 68416.m02285 expressed protein ; expression supported by MPSS Length = 211 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -3 Query: 226 DSDNSTSANAHVGHGDSSRSVCGQFTVENLDFSFSSVY 113 D D++ H G GDS RS G++ F +VY Sbjct: 105 DDDDAAGNGIHRGTGDSKRSSLGEYLEVERRFGDEAVY 142 >At5g45730.1 68418.m05622 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 519 Score = 27.5 bits (58), Expect = 5.7 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -3 Query: 259 VRVPDGVSVNTDSDNSTSANAHVGHGDSSRSVCGQ 155 + +P +++N D+ S H+GHGD VC Q Sbjct: 171 INLPRVININRH-DHKISRTYHLGHGDWECGVCRQ 204 >At4g31570.1 68417.m04483 expressed protein Length = 2712 Score = 27.5 bits (58), Expect = 5.7 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +1 Query: 298 LNLFGREVGGRISDFLNKLPYNLEKYQSQVSRVLEYVSEYI 420 +NL GG I++ L NL+++ VS + E VS+++ Sbjct: 2131 INLHETSSGGNIAEICGSLSQNLDQFVVGVSHLEEKVSKHL 2171 >At4g16835.1 68417.m02541 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 575 Score = 27.5 bits (58), Expect = 5.7 Identities = 9/37 (24%), Positives = 22/37 (59%) Frame = +3 Query: 324 RTHQRLLEQAPLQLRKIPIPGQPGFGVRLRIHHQQTS 434 R +R+ E +++ ++ +PG +R ++HH ++S Sbjct: 422 RVRKRMKESNVVKVERVKVPGYSWIEIRNKVHHFRSS 458 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,025,427 Number of Sequences: 28952 Number of extensions: 148259 Number of successful extensions: 515 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 515 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 947539968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -