BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0120 (787 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 27 0.26 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 24 1.8 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 24 1.8 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 24 1.8 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 23 2.4 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 3.2 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 22 7.4 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 22 7.4 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 26.6 bits (56), Expect = 0.26 Identities = 20/48 (41%), Positives = 25/48 (52%), Gaps = 6/48 (12%) Frame = -2 Query: 153 NNRVDRRRSSATVTVY-YYD-----NIRIIVKGRSSIVSSGKVVFGEC 28 N+ ++R SA V + YYD N+ V SSI SSG V GEC Sbjct: 126 NDYINRLNYSAFVNLTAYYDGGANLNLNGTVNCTSSIASSGVVSAGEC 173 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 23.8 bits (49), Expect = 1.8 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 414 DWENNVLRLGTNDAQYVEVIH 476 DW N+ + G N + +E+IH Sbjct: 232 DWLFNLTKYGKNQIKLLEIIH 252 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.8 bits (49), Expect = 1.8 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 166 LTSGDYNVIVVDWSSF 213 + +GDY V+ +WSSF Sbjct: 379 IQNGDYVVLETEWSSF 394 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 23.8 bits (49), Expect = 1.8 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 166 LTSGDYNVIVVDWSSF 213 + +GDY V+ +WSSF Sbjct: 85 IQNGDYVVLETEWSSF 100 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 23.4 bits (48), Expect = 2.4 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -3 Query: 773 NGYLCRYLLGTFQTHALQVWQYPFQL*ILGNYLRLSP 663 N + R++ + HA ++QY F + I R+SP Sbjct: 345 NALVLRHVQAEAEKHAAMLYQYNFNIIISEPTERISP 381 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 611 AATITHGKHYGNQCSTEAEITANN 682 A+ + K+Y CSTE +T N Sbjct: 441 ASVTPYNKNYTKFCSTEKRLTKQN 464 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 21.8 bits (44), Expect = 7.4 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 Query: 91 DIVVIIHGHSGTATTTINPIVK 156 +IVVI H SG +TTT + I K Sbjct: 9 NIVVIGHVDSGKSTTTGHLIYK 30 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.8 bits (44), Expect = 7.4 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 Query: 91 DIVVIIHGHSGTATTTINPIVK 156 +IVVI H SG +TTT + I K Sbjct: 9 NIVVIGHVDSGKSTTTGHLIYK 30 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 234,139 Number of Sequences: 438 Number of extensions: 5328 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24760908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -